DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB6 and unpg

Sequence 1:XP_011523029.1 Gene:HOXB6 HGNCID:5117 Length:288 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:352 Identity:86/353 (24%)
Similarity:127/353 (36%) Gaps:109/353 (31%)


Human     4 TPPSPGSLPENAQVSRHSRRREPRSTG----------RQFCGFNA------ARRSDYKTQQII-- 50
            |||||   ||.....:.:.:.:..|..          .||..:|.      |:..:..|..|.  
  Fly    46 TPPSP---PEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAGG 107

Human    51 ---------NPAEQQ-----RPRAPPLPMSSYFVNSTFPVTL--------------ASG------ 81
                     :||.||     :|:.||....::.:....|.||              |:|      
  Fly   108 CYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDL 172

Human    82 ---------QESFLGQLPLYSSGYADPLRHYPAP---------------YGPGPGQDKGFATSSY 122
                     .:.::..|.:::.     |:|..|.               ..|.|.|    |.|| 
  Fly   173 SYRRLAELMNQDYVHSLSVHAR-----LQHMAAAGRMHEDQANPGMAQLQEPTPPQ----AHSS- 227

Human   123 YPPAGGGYGRAAPC-DYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKS---VFGETE 183
             |...|.:....|. |.|....|....:|...:|       ....||..:...|||   .:..::
  Fly   228 -PAKSGSHSPMEPALDVGMDEDFECSGDSCSDIS-------LTMSPRNYNGEMDKSRNGAYTNSD 284

Human   184 EQKCSTPVYPWMQ--------RMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRR 240
            .:.||.......:        :.:..|.||.....||.|..:|..|.||||:|||..:||:...|
  Fly   285 SEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTER 349

Human   241 IEIAHALCLTERQIKIWFQNRRMKWKK 267
            .:||.:|.|:|.|:||||||||.|||:
  Fly   350 SQIATSLKLSEVQVKIWFQNRRAKWKR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB6XP_011523029.1 Homeobox 214..266 CDD:278475 29/52 (56%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.