DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wisp and Tailor

Sequence 1:NP_001285144.1 Gene:wisp FlyBaseID:FBgn0260780 Length:1373 Species:Drosophila melanogaster
Sequence 2:NP_001262327.1 Gene:Tailor FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster

Alignment Length:446 Identity:107/447 (24%)
Similarity:177/447 (40%) Gaps:110/447 (25%)


  Fly   878 VQHPLHQQHPPSHASHRPHGQMGGHAMSSYVPHRPPPPPHPSISSPNPTPVATGAGGPWYEMILP 942
            |.| |.:|||      :|:            |:..|..|||:..:......|.            
  Fly   164 VAH-LSEQHP------KPN------------PNNQPVQPHPTHQTKQEKKQAQ------------ 197

  Fly   943 PDRYLAQARNIEVTVQ-PEKLICMCKYDNLSAEIWKRFRGAQQTHNKFK-------LKMRLWRYL 999
                 .:||. .:||: |:|...|     :..||...|:......:|.|       ::..|.:.|
  Fly   198 -----VKARQ-HITVRLPKKARAM-----IVGEITNVFKDKYPIADKLKVIPEYDVIEQDLCKLL 251

  Fly  1000 YLWMHQPMFER--YRICLVGSTITGFGTDSSDIDMCL-LPEQGVHPHQHQYHQHHHFHNEKRTEA 1061
                 .|.|.:  .|:...||.|||.|..|||:|:.: :.:.|        :..|.|.:......
  Fly   252 -----SPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGKSG--------NTFHTFEHRASNAT 303

  Fly  1062 LIILTLFNAVLKDTEVFQDFNLIE-ARVPILRFKDISNGIEVDLNFNNCVGIKNTYLLQLYAQMD 1125
            :..|........|:|.::..|.|| |||||::...:..|||.|:..|: :|..||.||:...:..
  Fly   304 VAKLRAMRKFFCDSEDWRLINFIEQARVPIIKTCHLPTGIECDICLNS-MGFCNTNLLKYIFESQ 367

  Fly  1126 WRTRPLVVIVKLWAQYHDINDAKRMTISSYSLVLMVLHYLQHACVPHVLPCLHSLYPEKFQLGQQ 1190
            ..|:.:.:.||.|.:...:.:    .||:||:.|||:::||          |.:|.|....|..:
  Fly   368 PLTQYMCIYVKNWLERCKLTE----QISTYSITLMVIYFLQ----------LQALLPPIAMLQIE 418

  Fly  1191 DCLD-LDLIEP------IEPYQALNTQTLGE-------HLLGFFKYYSTFDFRNFAIS--IRTGG 1239
            |..: ..|:.|      .:.:..|..|.|..       .|..||.|::.||:.:|.:.  |....
  Fly   419 DAANQAVLVGPWVVNFAQKSFSELGLQQLKATVPVIKGFLRNFFAYFAKFDYEHFLVCPYIGQAN 483

  Fly  1240 VLPVSTCRM---------AKSPKNDVYQWKELNIEEPFDLS-NTARSV--YDGPTF 1283
            |......||         :.:|:..:...|.:.:::|..|: |..::|  |...||
  Fly   484 VEIAKIERMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHNVTKAVTKYGLQTF 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wispNP_001285144.1 NT_PAP_TUTase 987..1122 CDD:143392 41/146 (28%)
PAP_assoc 1211..1272 CDD:281779 16/80 (20%)
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 39/133 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C163460614
eggNOG 1 0.900 E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12271
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.