DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and abd-A

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_732176.1 Gene:abd-A FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster

Alignment Length:271 Identity:98/272 (36%)
Similarity:135/272 (50%) Gaps:51/272 (19%)


Human    26 SGSSLSG-SYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPAPAQEPRFRQAA 89
            :|:|.:| |...|:...:||...:.:..|.|...:|||:|...|...::.|..|.|      .|:
  Fly   193 AGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAA------AAS 251

Human    90 SSCSLSSPESLPCTNG--DSHGA-----------KPSASSPSD--------QATSASSSANFTEI 133
            ||.::.:.:..|..:.  .|||.           ..|.|..:|        .:..||:||.|.:.
  Fly   252 SSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQF 316

Human   134 DE---ASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEG-------QTPQIFPWMR------- 181
            .:   |:||:....:|..:...||..|..:|.:.......|       ..|: :|||.       
  Fly   317 YQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPR-YPWMTLTDWMGS 380

Human   182 --KLHISHDMTGPDG---KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIW 241
              :..:..|..||:|   :|.|..|||:||||||||||||.||||||||||||||||:|||||||
  Fly   381 PFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIW 445

Human   242 FQNRRMKWKKD 252
            |||||||.||:
  Fly   446 FQNRRMKLKKE 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207 27/128 (21%)
Antp-type hexapeptide 176..181 3/5 (60%)
Homeobox 198..250 CDD:306543 46/52 (88%)
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 46/52 (88%)
Abdominal-A 456..478 CDD:289192 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45659
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.