DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB5 and Ubx

DIOPT Version :9

Sequence 1:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:325 Identity:105/325 - (32%)
Similarity:135/325 - (41%) Gaps:100/325 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     6 VNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVG 70
            ||.:...:..|..    |.|.|....|.  ...|..||..| |.||       .:|::::    |
  Fly    97 VNGYKDIWNTGGS----NGGGGGGGGGG--GGGAGGTGGAG-NANG-------GNAANAN----G 143

Human    71 ESSRAFPAPAQEPRFRQAASSCS--------LSSPESLPCTN-GDSHGAKPSASSPSDQATSASS 126
            :::.|...|.:       .|:|:        |.:....|.:: |.|.|...|.|..:..|....|
  Fly   144 QNNPAGGMPVR-------PSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQS 201

Human   127 -----------SANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWM 180
                       :||.| |..|:|.:   .|||.|...|.....|. ||.:...||..|       
  Fly   202 GVGVAGAGTAWNANCT-ISGAAAQT---AAASSLHQASNHTFYPW-MAIAGECPEDPT------- 254

Human   181 RKLHISHDMT--------------------------GPDG--KRARTAYTRYQTLELEKEFHFNR 217
             |..|..|:|                          |.:|  :|.|..||||||||||||||.|.
  Fly   255 -KSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNH 318

Human   218 YLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKD--------------NKLKSMSLATAGSAFQ 268
            |||||||||:||||||:||||||||||||||.||:              ...|:.:.|.|.:|.|
  Fly   319 YLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQ 383

Human   269  268
              Fly   384  383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 29/123 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 28/115 (24%)
Antp-type hexapeptide 176..181 0/4 (0%)
Homeobox 198..251 CDD:395001 45/52 (87%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.