DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and Ubx

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster

Alignment Length:325 Identity:105/326 (32%)
Similarity:135/326 (41%) Gaps:100/326 (31%)


Human     6 VNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVG 70
            ||.:...:..|..    |.|.|....|.  ...|..||..| |.||       .:|::::    |
  Fly    97 VNGYKDIWNTGGS----NGGGGGGGGGG--GGGAGGTGGAG-NANG-------GNAANAN----G 143

Human    71 ESSRAFPAPAQEPRFRQAASSCS--------LSSPESLPCTN-GDSHGAKPSASSPSDQATSASS 126
            :::.|...|.:       .|:|:        |.:....|.:: |.|.|...|.|..:..|....|
  Fly   144 QNNPAGGMPVR-------PSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQS 201

Human   127 -----------SANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWM 180
                       :||.| |..|:|.:   .|||.|...|.....|. ||.:...||..|       
  Fly   202 GVGVAGAGTAWNANCT-ISGAAAQT---AAASSLHQASNHTFYPW-MAIAGECPEDPT------- 254

Human   181 RKLHISHDMT--------------------------GPDG--KRARTAYTRYQTLELEKEFHFNR 217
             |..|..|:|                          |.:|  :|.|..||||||||||||||.|.
  Fly   255 -KSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNH 318

Human   218 YLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKD--------------NKLKSMSLATAGSAFQ 268
            |||||||||:||||||:||||||||||||||.||:              ...|:.:.|.|.:|.|
  Fly   319 YLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQ 383

Human   269  268
              Fly   384  383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207 30/124 (24%)
Antp-type hexapeptide 176..181 0/5 (0%)
Homeobox 198..250 CDD:306543 45/52 (87%)
UbxNP_536752.1 Homeobox 299..351 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45659
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.