DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and Antp

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:356 Identity:111/357 (31%)
Similarity:141/357 (39%) Gaps:107/357 (30%)


Human     1 MSSYFVNSF------SGRYP-NG----PDYQLLNYGSGSSLSGSYRDPAAMHTGSYG----YNYN 50
            |:|||.||:      .|.|| ||    ...|:.:|...::..|:...|   ....|.    ||..
  Fly    11 MTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYP---RFPPYDRMPYYNGQ 72

Human    51 GMDLS-----VNRSSASSSHFGAV---GESSRAFPAPAQEPRFRQAAS-----SCSLSSPESL-- 100
            |||..     .:|..:.||..|.|   .:::.....|.|:.:.:|..|     ..:..:|:.|  
  Fly    73 GMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQ 137

Human   101 ---PCTNGDSH-----------------------GAKPSASSPS--DQATSASSSANFT------ 131
               ..|...:|                       |..|...||.  ||.:....:|..|      
  Fly   138 QLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMG 202

Human   132 --------------EIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAP------------- 169
                          ::.|...:........|.|......|.|:.|......|             
  Fly   203 HPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTP 267

Human   170 ---------EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRI 225
                     .|....::||||    |......:.||.|..|||||||||||||||||||||||||
  Fly   268 PSQNPNSQSSGMPSPLYPWMR----SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRI 328

Human   226 EIAHALCLSERQIKIWFQNRRMKWKKDNKLK 256
            ||||||||:|||||||||||||||||:||.|
  Fly   329 EIAHALCLTERQIKIWFQNRRMKWKKENKTK 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207 25/184 (14%)
Antp-type hexapeptide 176..181 3/5 (60%)
Homeobox 198..250 CDD:306543 49/52 (94%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45659
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.