DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and ftz

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_477498.1 Gene:ftz FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster

Alignment Length:232 Identity:87/233 (37%)
Similarity:108/233 (46%) Gaps:53/233 (23%)


Human    68 AVGESSRAFPAPAQE--------PRFRQAASSCSLSSPES--LPCTNGDSHGAKPSASSPSDQAT 122
            ||.....|.|||:.:        |...:......:.||:|  ....|||.  |.|..::|     
  Fly   139 AVSTKVTASPAPSYDQEYVTVPTPSASEDVDYLDVYSPQSQTQKLKNGDF--ATPPPTTP----- 196

Human   123 SASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISH 187
                    |.:......|.|.::..:.||.::::.....:.|   ||.|...  |.|.   ||..
  Fly   197 --------TSLPPLEGISTPPQSPGEKSSSAVSQEINHRIVT---APNGAGD--FNWS---HIEE 245

Human   188 DMTG--PDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWK 250
            .:..  .|.||.|..||||||||||||||||||:||||||:||:||.||||||||||||||||.|
  Fly   246 TLASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSK 310

Human   251 KDNKLKS------------------MSLATAGSAFQP 269
            ||..|.|                  .|.||.|:...|
  Fly   311 KDRTLDSSPEHCGAGYTAMLPPLEATSTATTGAPSVP 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207 24/113 (21%)
Antp-type hexapeptide 176..181 2/5 (40%)
Homeobox 198..250 CDD:306543 45/52 (87%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 29/132 (22%)
Homeobox 257..310 CDD:278475 45/53 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45659
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.