DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and Scr

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_001356915.1 Gene:Scr FlyBaseID:FBgn0003339 Length:508 Species:Drosophila melanogaster

Alignment Length:386 Identity:122/387 (32%)
Similarity:163/387 (42%) Gaps:129/387 (33%)


Human     1 MSSY-FVNSFSGRYPNGPDYQLLNYGSGSSLSG-------------------------------- 32
            |||| ||||.:..||...:.|..:.|:|:|.:|                                
  Fly     8 MSSYQFVNSLASCYPQQMNPQQNHPGAGNSSAGGSGGGAGGSGGVVPSGGTNGGQGSAGAATPGA 72

Human    33 -SYRDPAAMHT---------------GSYG-------YNYNGMD-----LSVNRSSASSSH---F 66
             .|...||.:|               .:||       .:|..:.     |...:......|   .
  Fly    73 NDYFPAAAAYTPNLYPNTPQAHYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAHAA 137

Human    67 GAVGESSRAFPA----PAQEPRFRQAASSCSLSSPESLPCTNGDSHGA--------KPSASSPSD 119
            .||....:...|    |.|:.:.:||..||..::.   |.|.|.|.|.        ..||:|.::
  Fly   138 AAVAAQQQQQLAQQQHPQQQQQQQQANISCKYAND---PVTPGGSGGGGVSGSNNNNNSANSNNN 199

Human   120 QATSASSSANFTEID---EASASSEPEEAASQLS----SPSLARAQ-----------------PE 160
            .:.|.:|..:.:..|   :.|.||..|..|..|:    ..|||.|.                 |.
  Fly   200 NSQSLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPG 264

Human   161 PMATSTAAPEG------------------------QTPQIFPWMRKLHISHDMTGPDG--KRART 199
            .:.....:|.|                        ..|||:|||:::|:.......:|  ||.||
  Fly   265 NVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRT 329

Human   200 AYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSL 260
            :|||||||||||||||||||||||||||||||||:|||||||||||||||||::|:.||::
  Fly   330 SYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNI 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207 32/140 (23%)
Antp-type hexapeptide 176..181 4/5 (80%)
Homeobox 198..250 CDD:306543 50/52 (96%)
ScrNP_001356915.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000808
OrthoInspector 1 1.000 T608751
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4748
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.