DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and Dfd

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_477201.1 Gene:Dfd FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster

Alignment Length:257 Identity:98/258 (38%)
Similarity:125/258 (48%) Gaps:48/258 (19%)


Human    25 GSGSSL-SGSYRDPAAMHTGSYGYNY---NGMDLSVNRSSASSSHFGAVGESSRAFPAPAQEPRF 85
            |||:.| .|:....|..:.|.||..|   ||        |..|:|.......|:....|.|    
  Fly   193 GSGAVLGGGAVGGSANGYYGGYGGGYGTANG--------SVGSTHSQGHSPHSQMMDLPLQ---- 245

Human    86 RQAASSCSLSSPESLPCTNGDSHGAK----PSASSPSDQATS-----------ASSSANFTEIDE 135
                  ||.:.|.:.........|.|    ...:.|:.|...           .|.:.:.:|.|.
  Fly   246 ------CSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDR 304

Human   136 ASASSEPEEAASQLSSPSLARAQPEP--MATSTAAPEGQTPQIFPWMRKLHIS-----HDMTGPD 193
            ......|:|..|..:...|..:..:.  ||.:|   :|:. .|:|||:|:|::     ....|.:
  Fly   305 LMLDRSPDELGSNDNDDDLGDSDSDEDLMAETT---DGER-IIYPWMKKIHVAGVANGSYQPGME 365

Human   194 GKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKL 255
            .||.||||||:|.||||||||:||||||||||||||.|.|||||||||||||||||||||||
  Fly   366 PKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207 20/121 (17%)
Antp-type hexapeptide 176..181 4/5 (80%)
Homeobox 198..250 CDD:306543 47/52 (90%)
DfdNP_477201.1 Homeobox 370..422 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.