DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and bcd

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_788587.1 Gene:bcd FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster

Alignment Length:94 Identity:36/95 (38%)
Similarity:49/95 (52%) Gaps:9/95 (9%)


Human   174 PQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQI 238
            |.:|| ..:|..|..|..|  :|.||.:|..|..|||:.|...||||..|..:::..|.|...|:
  Fly    80 PDVFP-SEELPDSLVMRRP--RRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQV 141

Human   239 KIWFQNRRMKWK------KDNKLKSMSLA 261
            ||||:|||.:.|      ||...:.|.|:
  Fly   142 KIWFKNRRRRHKIQSDQHKDQSYEGMPLS 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207
Antp-type hexapeptide 176..181 2/5 (40%)
Homeobox 198..250 CDD:306543 23/52 (44%)
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/47 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.