DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and zen

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_476793.1 Gene:zen FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster

Alignment Length:150 Identity:57/150 (38%)
Similarity:70/150 (47%) Gaps:36/150 (24%)


Human   105 GDSHGAKPSASSPS-DQATSASSSANFTEIDEASASSEPEEAASQ-LSSPSLARAQPEPMATSTA 167
            |..|...|....|: :|..|..::.|    |..|    |:....| :||.....:||        
  Fly    33 GHHHDVNPIGLPPNYNQMNSNPTTLN----DHCS----PQHVHQQHVSSDENLPSQP-------- 81

Human   168 APEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALC 232
                              :||......||:|||:|..|.:|||.||..|.||.|.||||||..|.
  Fly    82 ------------------NHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLS 128

Human   233 LSERQIKIWFQNRRMKWKKD 252
            |.|||:||||||||||:|||
  Fly   129 LCERQVKIWFQNRRMKFKKD 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207 15/68 (22%)
Antp-type hexapeptide 176..181 0/5 (0%)
Homeobox 198..250 CDD:306543 35/52 (67%)
zenNP_476793.1 Homeobox 93..146 CDD:278475 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.