DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and lab

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_476613.1 Gene:lab FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster

Alignment Length:314 Identity:79/315 (25%)
Similarity:112/315 (36%) Gaps:118/315 (37%)


Human    30 LSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGES--------SRAFPAPAQEPRFR 86
            |:|||...|....|.:.:.::|:         ...|.|.:..:        .:....|.|:|:..
  Fly   271 LAGSYALDAMDSLGMHAHMHHGL---------PHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHP 326

Human    87 QAASSCSLS-------SPESLPCTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASSEPEE 144
            |..|..:..       ||..  ..|....|...|..|.:..:||||:.|:              .
  Fly   327 QNQSPAAHQQHHQNSVSPNG--GMNRQQRGGVISPGSSTSSSTSASNGAH--------------P 375

Human   145 AASQLSSPSLARAQP--EPMATSTAAPEGQTPQI-FPWMRKLHISHDMTG--------------- 191
            |::|..||:.:.:.|  :.|......|:.|.|:: ...:..:| .:.|.|               
  Fly   376 ASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMH-DYQMNGQLDMCRGGGGGGSGV 439

Human   192 --------------------------------------PDG---------------------KRA 197
                                                  |:|                     ...
  Fly   440 GNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSG 504

Human   198 RTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKK 251
            ||.:|..|..||||||||||||||.||||||:.|.|:|.|:||||||||||.||
  Fly   505 RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKK 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207 24/121 (20%)
Antp-type hexapeptide 176..181 0/6 (0%)
Homeobox 198..250 CDD:306543 38/52 (73%)
labNP_476613.1 Homeobox 505..557 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.