DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and exex

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_648164.1 Gene:exex FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster

Alignment Length:252 Identity:78/253 (31%)
Similarity:103/253 (41%) Gaps:80/253 (32%)


Human    59 SSASSSHFGAVGE--------SSRAFPAPAQEPRFR-QAASSCSLSSPESLP-CTNGDS-HGA-- 110
            :.|::|..|.:.|        .||.:.:|:.:...| ::.:|...|||...| |.:... |||  
  Fly   272 AQAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALH 336

Human   111 ----------------KP----SASSPSD----------QATSASSSANFTEIDEASASSEP--- 142
                            ||    |...|.|          |..:...||....:|   .|.:|   
  Fly   337 PQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLD---PSGKPIPI 398

Human   143 ----EEAASQLSSPSLARAQ------PEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRA 197
                ....|||....||||.      ||..|....|..|:|                     :|.
  Fly   399 PMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKT---------------------RRP 442

Human   198 RTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNK 254
            |||:|..|.|||||:|..|:||:|.:|.|:|..|.|||.|:||||||||||||:..|
  Fly   443 RTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207 37/160 (23%)
Antp-type hexapeptide 176..181 0/5 (0%)
Homeobox 198..250 CDD:306543 34/52 (65%)
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.