DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB5 and unpg

Sequence 1:NP_002138.1 Gene:HOXB5 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:249 Identity:78/250 (31%)
Similarity:98/250 (39%) Gaps:75/250 (30%)


Human    33 SYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVG--ESSRAFP--APAQEPRFRQAASSCS 93
            |||..|.:....|.::     |||:   |...|..|.|  ...:|.|  |..|||...||.||.:
  Fly   173 SYRRLAELMNQDYVHS-----LSVH---ARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPA 229

Human    94 LS---SP----------ESLPCTNGDSHGAKPSASSPSDQATSASSSAN--FTEIDEASASSEPE 143
            .|   ||          |...| :|||........||.:.......|.|  :|..|....|.: |
  Fly   230 KSGSHSPMEPALDVGMDEDFEC-SGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDD-E 292

Human   144 EAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPD-----------GKRA 197
            .|.|:                                   |....|.|.|           .:|.
  Fly   293 GAQSR-----------------------------------HEGGGMGGKDSQGNGSSSNSKSRRR 322

Human   198 RTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKK 251
            |||:|..|.||||:|||..:||:...|.:||.:|.|||.|:||||||||.|||:
  Fly   323 RTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 DNA_pol3_gamma3 <67..>171 CDD:331207 30/123 (24%)
Antp-type hexapeptide 176..181 0/5 (0%)
Homeobox 198..250 CDD:306543 32/52 (62%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.