DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP7 and PAA2

Sequence 1:NP_001259466.1 Gene:ATP7 FlyBaseID:FBgn0030343 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_001031920.1 Gene:PAA2 AraportID:AT5G21930 Length:883 Species:Arabidopsis thaliana

Alignment Length:1026 Identity:306/1027 (30%)
Similarity:489/1027 (48%) Gaps:211/1027 (21%)


  Fly   184 PTPPPPSYAQNGSAVAIPVEQELLTKCFLHIRGMTCASCVAAIEKHCKKIYGLDSILVALLAAKA 248
            |.|||       |::.|...:.|:.:||..:|.       :.|.:||.:.:.|.|..|.:    :
plant     9 PLPPP-------SSLHIRPSKFLVNRCFPRLRR-------SRIRRHCSRPFFLVSNSVEI----S 55

  Fly   249 EVKFNANVVTAENIAKSITELGFPTELIDEPDNGEAEVELEIMGMTCASCVNKIESHVLKIRGVT 313
            ...|.:...:.|:: ||||.        |.|      :.|::.||.|..||.:::|.::....|.
plant    56 TQSFESTESSIESV-KSITS--------DTP------ILLDVSGMMCGGCVARVKSVLMSDDRVA 105

  Fly   314 TASVTLLTKRGKFRY-----ITEETGPRSICEAIEALGFEAKLMTGRDKMAHNYLEHKEEIRKWR 373
            :|.|.:||:....::     :|.:|. .|:.:.:...|||||.......:|.|       ::||:
plant   106 SAVVNMLTETAAVKFKPEVEVTADTA-ESLAKRLTESGFEAKRRVSGMGVAEN-------VKKWK 162

  Fly   374 NAFLVS----LIFGGPCMVAMIYFMLEMSDKGHANMCCLVPGLSMEN---------------LVM 419
            .  :||    |:......||..:.::.:....|.:......|:.:.:               |.:
plant   163 E--MVSKKEDLLVKSRNRVAFAWTLVALCCGSHTSHILHSLGIHIAHGGIWDLLHNSYVKGGLAV 225

  Fly   420 FLLSTPVQFFGGFHFYVQSYRAIKHGTTNMDVLISMVTTISYVYSVAVVIAAVLLEQNSSPLTFF 484
            ..|..|     |........:|....:.||:.|:.:.:..::..|: :.:....||.::|   ||
plant   226 GALLGP-----GRELLFDGIKAFGKRSPNMNSLVGLGSMAAFSISL-ISLVNPELEWDAS---FF 281

  Fly   485 DTPPMLLIFISLGRWLEHIAKGKTSEALSKLLSLKAADALLVEISPDFDIISEKV---------I 540
            |.|.|||.|:.|||.||..||.:.|..:::||||.:..:.||..|.|.:...:.|         :
plant   282 DEPVMLLGFVLLGRSLEERAKLQASTDMNELLSLISTQSRLVITSSDNNTPVDSVLSSDSICINV 346

  Fly   541 SVDYVQRGDILKVIPGAKVPVDGKVLYGHSSCDESLITGESMPVAKRKGSVVIGGSINQNGVLLV 605
            |||.::.||.|.|:||...||||.||.|.|..|||::||||:||.|.:|..|..|:||.:|.|.:
plant   347 SVDDIRVGDSLLVLPGETFPVDGSVLAGRSVVDESMLTGESLPVFKEEGCSVSAGTINWDGPLRI 411

  Fly   606 EATHTGENTTLAQIVRLVEEAQTSKAPIQQLADRIAGYFVPFVVVVSSITLIAWIIIGFSNPNLV 670
            :|:.||.|:|:::|||:||:||.:.||:|:|||.|||.||..::.:|::|...|..:|   .::.
plant   412 KASSTGSNSTISKIVRMVEDAQGNAAPVQRLADAIAGPFVYTIMSLSAMTFAFWYYVG---SHIF 473

  Fly   671 P-VAMEHKMHMDQNTIIVSYAFKCALSVLAIACPCALGLATPTAVMVATGTGAINGVLVKGATAL 734
            | |.:......|.:.:.:|  .|.|:.||.::||||||||||||:::.|..||..|.|::|...|
plant   474 PDVLLNDIAGPDGDALALS--LKLAVDVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVL 536

  Fly   735 ENAHKVKTVVFDKTGTITHGTPMTSKVTLFVTAQVCSLA----RALTIVGAAEQNSEHPIASAIV 795
            |....:..|..|||||:|.|.|        |.:.|.||.    ..|.:..|.|:.:.||||.|||
plant   537 ERLASIDCVALDKTGTLTEGRP--------VVSGVASLGYEEQEVLKMAAAVEKTATHPIAKAIV 593

  Fly   796 HFAKDMLNVGATPQAGSFGKSSHFQAVPGCGIRVTVSNYEQTLRQACNADRIINYENLHRTHPQG 860
            :.| :.||:......|...:       ||.|          ||.:                    
plant   594 NEA-ESLNLKTPETRGQLTE-------PGFG----------TLAE-------------------- 620

  Fly   861 SVPVDNGASIEHLLPQRSVRKSMELNNQQLLSDLVLEPEEELLTDQKIIDSPEILVLIGNREW-- 923
                                                            ||..  .|.:|:.||  
plant   621 ------------------------------------------------IDGR--FVAVGSLEWVS 635

  Fly   924 ---MERNAIEVPLEISDCMTHE-------ERKGHTAVLCALNGQ-LVCMFAVSDMVKPEAHLAVY 977
               :::|.....:::...:.|:       .|...|.|.....|: ::...|:||.::.:|...|.
plant   636 DRFLKKNDSSDMVKLESLLDHKLSNTSSTSRYSKTVVYVGREGEGIIGAIAISDCLRQDAEFTVA 700

  Fly   978 TLKRMGIDVVLLTGDNKNTAASIAREVGIR---TVYAEVLPSHKVAKIQRIQANGIRVAMVGDGV 1039
            .|:..||..|||:||.:...|::|:.|||:   |.|: :.|..|...|..:|::|.||||||||:
plant   701 RLQEKGIKTVLLSGDREGAVATVAKNVGIKSESTNYS-LSPEKKFEFISNLQSSGHRVAMVGDGI 764

  Fly  1040 NDSPALAQADVGIT--IAAGTDVAAEASDIVLMRNDLLDVVACLDLSRCTVRRIRYNFFFASMYN 1102
            ||:|:||||||||.  |.|..:.|:.|:.::|:||.|..||..|.|::.|:.::..|..:|..||
plant   765 NDAPSLAQADVGIALKIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYN 829

  Fly  1103 LLGIPLASGLFAP-YGFTLLPWMASVAMAASSVSVVCSSLLLKMYRKPTAK 1152
            ::.||:|:|:..| |.|.:.|.::...||.||:.||.:||||::::..|:|
plant   830 VISIPIAAGVLLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQLHKSETSK 880

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP7NP_001259466.1 HMA 16..78 CDD:238219
HMA 97..159 CDD:238219
HMA 214..274 CDD:238219 13/60 (22%)
ZntA 285..1131 CDD:225127 272/903 (30%)
HMA 287..350 CDD:238219 19/68 (28%)
E1-E2_ATPase 489..735 CDD:278548 109/256 (43%)
COG4087 <984..1085 CDD:226572 49/106 (46%)
PAA2NP_001031920.1 ZntA 80..871 CDD:225127 279/912 (31%)
HMA 80..146 CDD:238219 19/67 (28%)
E1-E2_ATPase 285..537 CDD:278548 109/257 (42%)
COG4087 681..799 CDD:226572 50/119 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D649559at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43520
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.