DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP7 and ATP7B

Sequence 1:NP_001259466.1 Gene:ATP7 FlyBaseID:FBgn0030343 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_000044.2 Gene:ATP7B HGNCID:870 Length:1465 Species:Homo sapiens

Alignment Length:1234 Identity:577/1235 (47%)
Similarity:771/1235 (62%) Gaps:143/1235 (12%)


  Fly    13 TVRLPIVGMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARIASDIDDM---G 74
            |::|.|.||.|:|||.||.|:|||..|:..::|.||.......|||..|.|..:...|:.:   .
Human   258 TLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGN 322

  Fly    75 FECSYP----GDAAD-----------PPETPAS---AWTNIRVVGMTCQSCVRNIEGNIGTKPGI 121
            |:.|.|    |...|           ||.....   :.|.|.:.||||.|||.:|||.|....|:
Human   323 FKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGV 387

  Fly   122 HSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFEASVQEPRSPSQSPSP----APASSPKKRA 182
            ..|.|.||...|.|.|:|:...|.::...|:||||||||.   |.|.|.:|    :..:|..:..
Human   388 QQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVV---SESCSTNPLGNHSAGNSMVQTT 449

  Fly   183 TPTPP------------PPSYA--------QNGSAVAIPVEQELLTKCFLHIRGMTCASCVAAIE 227
            ..||.            |.::|        |:..||| |      .||||.|:||||||||:.||
Human   450 DGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVA-P------QKCFLQIKGMTCASCVSNIE 507

  Fly   228 KHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELGFPTELIDEPDNGEAEVELEIMG 292
            ::.:|..|:.|:||||:|.|||:|::..|:....||:.|.:|||...::::....:..:||.|.|
Human   508 RNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITG 572

  Fly   293 MTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKLMTGRDK 357
            |||||||:.|||.:.:..|:|.|||.|.|.:...::..|..|||.|.:.||.:||.|.| ..|:.
Human   573 MTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASL-AQRNP 636

  Fly   358 MAHNYLEHKEEIRKWRNAFLVSLIFGGPCMVAMIYFMLEMSDKGHANMCC---LVPGLSMENLVM 419
            .|| :|:||.||::|:.:||.||:||.|.|..||| ||..|::.|.:|..   ::||||:.||:.
Human   637 NAH-HLDHKMEIKQWKKSFLCSLVFGIPVMALMIY-MLIPSNEPHQSMVLDHNIIPGLSILNLIF 699

  Fly   420 FLLSTPVQFFGGFHFYVQSYRAIKHGTTNMDVLISMVTTISYVYSVAVVIAAVLLEQNSSPLTFF 484
            |:|.|.||..||::||||:|::::|.:.||||||.:.|:|:||||:.:::.||..:...||:|||
Human   700 FILCTFVQLLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFF 764

  Fly   485 DTPPMLLIFISLGRWLEHIAKGKTSEALSKLLSLKAADALLVEISPDFDIISEKVISVDYVQRGD 549
            ||||||.:||:|||||||:||.||||||:||:||:|.:|.:|.:..|..||.|:.:.::.|||||
Human   765 DTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGD 829

  Fly   550 ILKVIPGAKVPVDGKVLYGHSSCDESLITGESMPVAKRKGSVVIGGSINQNGVLLVEATHTGENT 614
            |:||:||.|.|||||||.|::..||||||||:|||.|:.||.||.||||.:|.:|::|||.|.:|
Human   830 IVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDT 894

  Fly   615 TLAQIVRLVEEAQTSKAPIQQLADRIAGYFVPFVVVVSSITLIAWIIIG----------FSNPNL 669
            ||||||:||||||.|||||||||||.:||||||::::|::||:.||:||          |.||| 
Human   895 TLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPN- 958

  Fly   670 VPVAMEHKMHMDQNTIIVSYAFKCALSVLAIACPCALGLATPTAVMVATGTGAINGVLVKGATAL 734
                    .|:.|..:|:.:||:.:::||.|||||:|||||||||||.||..|.||:|:||...|
Human   959 --------KHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPL 1015

  Fly   735 ENAHKVKTVVFDKTGTITHGTPMTSKVTLFVTAQVCSLARALTIVGAAEQNSEHPIASAIVHFAK 799
            |.|||:|||:||||||||||.|...:|.|........|.:.|.:||.||.:||||:..|:..:.|
Human  1016 EMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCK 1080

  Fly   800 DMLNVGATPQAGSFGKSSHFQAVPGCGIRVTVSNYEQTLRQACNADRIINYENLHRTHPQGSVPV 864
            :.|.      ..:.|..:.|||||||||...|||.|..|   .:::|.::....| .:..||:|.
Human  1081 EELG------TETLGYCTDFQAVPGCGIGCKVSNVEGIL---AHSERPLSAPASH-LNEAGSLPA 1135

  Fly   865 DNGASIEHLLPQRSVRKSMELNNQQLLSDLVLEPEEELLTDQKIIDSPEILVLIGNREWMERNAI 929
            :..|     :||                                    ...||||||||:.||.:
Human  1136 EKDA-----VPQ------------------------------------TFSVLIGNREWLRRNGL 1159

  Fly   930 EVPLEISDCMTHEERKGHTAVLCALNGQLVCMFAVSDMVKPEAHLAVYTLKRMGIDVVLLTGDNK 994
            .:..::||.||..|.||.||:|.|::|.|..|.|::|.||.||.|||:||:.||:||||:||||:
Human  1160 TISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNR 1224

  Fly   995 NTAASIAREVGIRTVYAEVLPSHKVAKIQRIQANGIRVAMVGDGVNDSPALAQADVGITIAAGTD 1059
            .||.:||.:|||..|:|||||||||||:|.:|..|.:||||||||||||||||||:|:.|..|||
Human  1225 KTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGKKVAMVGDGVNDSPALAQADMGVAIGTGTD 1289

  Fly  1060 VAAEASDIVLMRNDLLDVVACLDLSRCTVRRIRYNFFFASMYNLLGIPLASGLFAPYGFTLLPWM 1124
            ||.||:|:||:|||||||||.:.||:.||||||.|...|.:|||:|||:|:|:|.|.|..|.|||
Human  1290 VAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWM 1354

  Fly  1125 ASVAMAASSVSVVCSSLLLKMYRKPTAKTLRTAEYEAQLAAERASGSEDEL--DKLSLHRGLDD 1186
            .|.||||||||||.|||.||.|:||..:     .||||     |.|....|  .::|:|.|:||
Human  1355 GSAAMAASSVSVVLSSLQLKCYKKPDLE-----RYEAQ-----AHGHMKPLTASQVSVHIGMDD 1408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP7NP_001259466.1 HMA 16..78 CDD:238219 25/65 (38%)
HMA 97..159 CDD:238219 29/62 (47%)
HMA 214..274 CDD:238219 30/60 (50%)
ZntA 285..1131 CDD:225127 438/859 (51%)
HMA 287..350 CDD:238219 31/63 (49%)
E1-E2_ATPase 489..735 CDD:278548 148/256 (58%)
COG4087 <984..1085 CDD:226572 71/101 (70%)
ATP7BNP_000044.2 HMA 61..124 CDD:238219
HMA 146..209 CDD:238219
HMA 260..318 CDD:238219 24/58 (41%)
HMA 363..425 CDD:238219 29/62 (47%)
HMA 492..554 CDD:238219 31/62 (50%)
ZntA 566..1355 CDD:225127 434/852 (51%)
HMA 567..630 CDD:238219 31/63 (49%)
E1-E2_ATPase 769..1016 CDD:278548 148/256 (58%)
COG4087 <1206..1309 CDD:226572 73/103 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C346367666
eggNOG 1 0.900 E1_COG2217
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1029 1.000 Inparanoid score I270
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D33208at33208
OrthoFinder 1 1.000 FOG0002052
OrthoInspector 1 1.000 T610221
orthoMCL 1 0.900 OOG5_126855
Panther 1 1.100 LDO PTHR43520
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R123
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.