DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP7 and SPoCk

Sequence 1:NP_001259466.1 Gene:ATP7 FlyBaseID:FBgn0030343 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_001262220.1 Gene:SPoCk FlyBaseID:FBgn0052451 Length:1062 Species:Drosophila melanogaster

Alignment Length:1136 Identity:222/1137 (20%)
Similarity:397/1137 (35%) Gaps:394/1137 (35%)


  Fly   169 SPSPAPASSPKKRATPTPPPPSYAQNGSAVAIPVEQELLTKCFLHIRGMTCASCVAAIEKHCKKI 233
            |.:|.|.:| |:|.:|..|       ||.|.              |...|.:|   .:.....||
  Fly     2 SKTPKPLTS-KRRTSPASP-------GSTVL--------------IESPTTSS---GVRNRRSKI 41

  Fly   234 YGLDSILVALLAAKAEVKFN-ANVVTAENIAKSITELGFPTELID-----EPDNGEAEVELEIMG 292
            .|:||            |.| ...::....::::.:...|.::.|     |||...         
  Fly    42 KGVDS------------KPNPQRTISHVKDSRAVPQNVKPGKVADMKDCKEPDEDN--------- 85

  Fly   293 MTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKLMTG--- 354
                  |::...:::: .|:|.....||:        |.|:...|..|....|  :..:.||   
  Fly    86 ------VDQQNGNIIQ-TGLTLTPEMLLS--------TSESSTHSASEVAGRL--QVDVRTGLKW 133

  Fly   355 -----RDK-MAHNYL-------EHKEEIRKWRNAFLVSLIFGGPCMVAMIYFMLEMSDKGHANMC 406
                 |.| :.||.|       ..|:.|.::||..::.|:  |..:|::|  |.:..|       
  Fly   134 TEAKYRAKIIGHNELLLVAEDPTWKKYIEQFRNPLILLLL--GSALVSVI--MKQFDD------- 187

  Fly   407 CLVPGLSMENLVMFLLSTPVQFFGGFHFYVQSYRAIKHGTTNMDVLISMVTTISYVYSVAVVIAA 471
                  ::...:..|:...|.|       :|.||:.|    :::.|..:|               
  Fly   188 ------AVSITIAILIVVTVAF-------IQEYRSEK----SLEELKKLV--------------- 220

  Fly   472 VLLEQNSSPLTFFDTPPMLLIFISLGRWLEH-IAKGKTSEALSKLLSLKAADALLVEISPDFDII 535
                           ||..           | :.:|:....|::            |:.|     
  Fly   221 ---------------PPEC-----------HCLREGRLDTFLAR------------ELVP----- 242

  Fly   536 SEKVISVDYVQRGDILKVIPGAKVPVDGKVLYG-HSSCDESLITGESMPVAK------------- 586
                        |||:.:..|.:||.|.::... ..|.|||..|||:.|..|             
  Fly   243 ------------GDIVHLNVGDRVPADVRLFEAVDLSIDESSFTGETEPARKITDVLLNNTNVKD 295

  Fly   587 ---RKGSVVIGGSI---NQNGVLLVEATHTGENTTLAQIVRLVEEAQTSKAPIQQLADRIAGYFV 645
               .|....:|..:   |..|:::    .|||.:...::.::::..:..|.|:|:..| |.|..:
  Fly   296 HSNMKNIAFMGTLVRCGNGKGIVV----STGERSEFGEVFKMMQAEEAPKTPLQKSMD-ILGAQL 355

  Fly   646 PF--VVVVSSITLIAWIIIGFSNPNLVPVAMEHKMHMDQNTIIVSYAFKCALSVLAIACPCALGL 708
            .|  .:::..|.|:.|:   ...|                   :|..|..::|:...|.|..|  
  Fly   356 SFYSFLIIGVIMLLGWL---QGKP-------------------LSEMFNISVSLAVAAIPEGL-- 396

  Fly   709 ATPTAVMVATGTG----AINGVLVKGATALENAHKVKTVVFDKTGTITHGTPMTSKVTLFVTAQV 769
              |..|.|....|    |....:||....:|....|..:..|||||:|. ..||:  |:.:|:. 
  Fly   397 --PIVVTVTLALGVMRMAKRNSIVKKLPTVETLGCVNVICSDKTGTLTK-NEMTA--TIIITSD- 455

  Fly   770 CSLARALTIVGAAEQNSEHPIASAIVHFAK----DMLNVGAT-----PQAGS-FGKSSHFQAVPG 824
             .....:|..|..:|...|......|..||    ::|.:||.     .|.|: .|:.:....|..
  Fly   456 -GYMADVTGAGYNDQGEIHIRHCNNVEMAKTNITNLLEIGAVCNNAYIQNGTLLGQPTEGALVAV 519

  Fly   825 C---GIRVTVSNYEQTLRQACNAD-RIINYENLHR-THPQGSVPVDNGASIEHLLPQRSVRKSME 884
            .   |:..|..||.:......::: :::..:.:|: .:.:..:....|| :|.||||.:   ..:
  Fly   520 AMKNGMYATAENYVRIQEYPFSSEQKMMAVKCIHKYNNNKEEIFFAKGA-LETLLPQCT---KYQ 580

  Fly   885 LNNQQLLSDLVLEPEEELLTDQKIIDSPEILVLIGNREWMERNAIEVPLEISDCMTHEERKGHTA 949
            ...|.:  .|..:.|.|.|.:...|....:.||          |:.....:.|           .
  Fly   581 FGTQTV--PLTKQNEAEFLAEAYEIGRKGLRVL----------ALAKGRSMQD-----------L 622

  Fly   950 VLCALNGQLVCMFAVSDMVKPEAHLAVYTLKRMGIDVVLLTGDNKNTAASI-------------- 1000
            :.|.|.|       ::|..:|....::..|.:.|:.|.::|||.:.||.:|              
  Fly   623 IYCGLVG-------ITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIDPSRRLQAVPTHAI 680

  Fly  1001 --------------------------------------------AREVGIRTVYAEVL------- 1014
                                                        |..:||.|::.:.|       
  Fly   681 PAWPTAGGVPLCSASACCSTNCLENAMKEIYLTALAQQGLPLVTANLIGIDTIHHQTLSGQEMDQ 745

  Fly  1015 --------------------PSHKVAKIQRIQANGIRVAMVGDGVNDSPALAQADVGITIAA-GT 1058
                                |.||:..::.:|.:|..|.|.||||||..||.:||:||.:.. ||
  Fly   746 MNEHQLDKVANNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKNGT 810

  Fly  1059 DVAAEASDIVLMRNDLLDVVACLDLSRCTVRRIRYNFFFASMYNLLGIPLASGLFAPYGFTLLPW 1123
            ||..||:|::|:.:|...::|.::..:.....||         |.:...|::.: |......|..
  Fly   811 DVCKEAADMILVNDDFHTIIAAIEEGKGIFYNIR---------NFVRFQLSTSI-AALALIALAT 865

  Fly  1124 MASVAMAASSVSVVCSSLLLKMYRKPTAKTL 1154
            :..:|...:::.::..::::.   .|.|::|
  Fly   866 LMDIANPLNAMQILWINIIMD---GPPAQSL 893

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP7NP_001259466.1 HMA 16..78 CDD:238219
HMA 97..159 CDD:238219
HMA 214..274 CDD:238219 11/61 (18%)
ZntA 285..1131 CDD:225127 193/990 (19%)
HMA 287..350 CDD:238219 10/63 (16%)
E1-E2_ATPase 489..735 CDD:278548 52/273 (19%)
COG4087 <984..1085 CDD:226572 41/187 (22%)
SPoCkNP_001262220.1 COG4087 <760..823 CDD:226572 27/63 (43%)
Cation_ATPase_C 872..1044 CDD:279079 3/26 (12%)
ATPase-IIA2_Ca 110..1049 CDD:130585 190/968 (20%)
Cation_ATPase_N 112..179 CDD:279080 17/71 (24%)
E1-E2_ATPase 191..425 CDD:278548 63/346 (18%)
Cation_ATPase 496..579 CDD:289987 16/87 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105368166
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.