DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP7 and CG6230

Sequence 1:NP_001259466.1 Gene:ATP7 FlyBaseID:FBgn0030343 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_609490.1 Gene:CG6230 FlyBaseID:FBgn0027582 Length:1225 Species:Drosophila melanogaster

Alignment Length:1125 Identity:204/1126 (18%)
Similarity:358/1126 (32%) Gaps:413/1126 (37%)


  Fly   206 LLTKCFLHIRGMTCASCVAAIEKHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELG 270
            :|...||||  :|...|..::.            ::|.|..:......|||     :||.:    
  Fly   111 VLAIAFLHI--LTLLFCYWSVH------------VLAFLTCRRVKLPGANV-----LAKVV---- 152

  Fly   271 FPTELIDEPDNGEAEVELEIMGMTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGP 335
             ||     |:||.:::               :.....|:...:|....:..|.   :|:..|  .
  Fly   153 -PT-----PNNGNSKI---------------VPIRSSKLEDGSTQYYFVFQKT---KYVWNE--D 191

  Fly   336 RSICEAIE--ALGFEAKLMTGRDKMAHNYLEHKEEIRKWRNAFLVSLIFGGPCMVAMIYFMLEMS 398
            |....|:|  ..|..:...:.|.      ||.:|:|::....:                      
  Fly   192 RKTFRAVEFPVNGLLSTYSSSRG------LETEEDIKRATQTY---------------------- 228

  Fly   399 DKGHANMCCLVPGLSMENLVMFLLSTPVQFFGGFHFYVQSYRAIKHGTTNMDVLISMVTTISYVY 463
              |:..|..:||    |...:|:......||        .::....|...||..        :.|
  Fly   229 --GNNEMEMVVP----EFHELFIERATAPFF--------VFQVFSVGLWCMDDY--------WYY 271

  Fly   464 SVAVVIAAVLLE--------QNSSPLTFFDTPPMLLIFISLGRWLEHIAKGKTSEALSKLLSLKA 520
            |:..:...:..|        :|.|.:......|.|:......:| .|:...              
  Fly   272 SLFTLFMLIAFECTIVKQQLRNMSEIRKMGNKPYLIYAFRQNKW-RHLGSD-------------- 321

  Fly   521 ADALLVEISPDFDIISEKVISVDYVQRGDILKVIPGAKVPVDGKVLYGHSSCDESLITGESMPVA 585
                        :::...::|:...|..:|        ||.|..:|.|....|||::||||:|:.
  Fly   322 ------------ELLPGDLVSITRSQNDNI--------VPCDLVILRGSCIVDESMLTGESVPLM 366

  Fly   586 KR------------------KGSVVIGGS-INQ------------NGVLLVEATHTGENTTLAQI 619
            |.                  |..|:.||: :.|            :|..:.....||.||:..::
  Fly   367 KESLESLDNLDVEMDAEGDGKLFVLFGGTKVVQHTAPTKESLRAPDGGCIGYVIRTGFNTSQGKL 431

  Fly   620 VR--LVEEAQTSKAPIQQLADRIAGYFVPFVVVVSSITLIAWIIIGFSNPNLVPVAMEHKMHMDQ 682
            :|  |....:.::..::..|      |:.|::|. ::...:::.:..|..   |....:|:.::.
  Fly   432 LRTILFGANRATENNVETFA------FIAFLMVF-AVAAASYVWVKGSED---PERNRYKLFLEC 486

  Fly   683 NTIIVSYAFKCALSVLAIACPCALGLATPTAVMVATGTGAINGVLVKGATALENAHKVKTVVFDK 747
            ..|:.        |::....|..|.||..|:::..|..    .|.......:..|.||:...|||
  Fly   487 TLILT--------SIIPPDLPIELTLAVNTSLIQLTKL----FVFCTEPFRIPFAGKVQICCFDK 539

  Fly   748 TGTITHGTPMTSKVTLFV--------------TAQVCSLARALTIV--GAAEQNSEHPIASAIVH 796
            |||:|....|...:....              |.||.:...:|.::  |......|....:|:..
  Fly   540 TGTLTTDNLMVEGIAGLAPNGACVPIEKAEGNTVQVLACCHSLALLDDGLVGDPLEKATLAAVDW 604

  Fly   797 FAKDMLNVGATPQAGSFG-----KSSHFQAVPGCGIRVTVSNYEQTLRQACNADRIINYENLHRT 856
            ....|.:|  .|:...|.     :..||.:.              ..|.:..|..:|.|.|    
  Fly   605 TLTKMDSV--IPKRPQFKPLKIIQRYHFSSA--------------LKRMSVLAGHLIPYSN---- 649

  Fly   857 HPQGSVPVDNGASIEHLLPQRSVRKSMELNNQQLLSDLVLEPEEELLTDQKIIDSPEILVLIGNR 921
                        .::|:   .:|:.:.|: .|::|.::..:.|:..|                  
  Fly   650 ------------EVKHI---GAVKGAPEV-IQKMLREVPADYEKVYL------------------ 680

  Fly   922 EWMERNAIEVPLEISDC----------MTHEERKGHTAVLCALN--GQLVCMFAVSDMVKPEAHL 974
            |:..|.|..:.|.|.|.          |..||      |.|.|.  |.|:    :|..:||::..
  Fly   681 EYARRGARVLALGIKDLGTLGAQRVREMKREE------VECDLTFAGFLI----ISCPMKPDSKS 735

  Fly   975 AVYTLKRMGIDVVLLTGDNKNTAASIAREV----------------------------------- 1004
            .:..|.:....||::|||:..||..:|||:                                   
  Fly   736 VIKELIQSSHKVVMITGDSPLTACHVARELRFTRKKLIILTPPEEDRKNNWSWVSIDGDQSYELD 800

  Fly  1005 ----------------------GIR-----------------TVYAEVLPSHKVAKIQRIQANGI 1030
                                  |::                 ||.|...|..|...|.:::..|.
  Fly   801 TKPGSKKLSHLLATHDLCITGEGLQYLQQNQPQYMRQLLPQITVCARFAPKQKELVITQLKQLGY 865

  Fly  1031 RVAMVGDGVNDSPALAQADVGITI----------------AAGTDVAAEASDIVLMRNDLLDVVA 1079
            ...|.|||.||..||..|:||:::                .|..:.||.|:......|..|..  
  Fly   866 CTLMCGDGTNDVGALKHANVGVSLLTSAPVKRKRTEEEQQQAAANAAAIAAQAQANANQQLTT-- 928

  Fly  1080 CLDLSRCTVRRIRY-NFFFASMYNLLG-------IPLA-SGLFAPYGFTLLPWMASVAMAASSVS 1135
               ..|...||..: |...|.:.|.|.       :.|. :.:.||:             .:.|.|
  Fly   929 ---RERALRRRQEHLNQTQARLQNALRDMEEQTMVKLGDASIAAPF-------------TSKSSS 977

  Fly  1136 VVCSSLLLKMYRKPTAKTLR 1155
            ::|.:.::|..|.....||:
  Fly   978 IMCVNHIIKQGRCTLVTTLQ 997

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP7NP_001259466.1 HMA 16..78 CDD:238219
HMA 97..159 CDD:238219
HMA 214..274 CDD:238219 12/60 (20%)
ZntA 285..1131 CDD:225127 178/1021 (17%)
HMA 287..350 CDD:238219 9/65 (14%)
E1-E2_ATPase 489..735 CDD:278548 48/279 (17%)
COG4087 <984..1085 CDD:226572 35/191 (18%)
CG6230NP_609490.1 P-ATPase-V 109..1193 CDD:273738 204/1126 (18%)
E1-E2_ATPase 310..515 CDD:278548 46/258 (18%)
Cation_ATPase <590..664 CDD:289987 16/110 (15%)
COG4087 <850..901 CDD:226572 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105221317
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.