DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP7 and Atp7b

Sequence 1:NP_001259466.1 Gene:ATP7 FlyBaseID:FBgn0030343 Length:1254 Species:Drosophila melanogaster
Sequence 2:XP_017455480.1 Gene:Atp7b RGDID:2180 Length:1513 Species:Rattus norvegicus

Alignment Length:1399 Identity:599/1400 (43%)
Similarity:790/1400 (56%) Gaps:260/1400 (19%)


  Fly     2 PSDERVEATMSTVRLPIVGMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARI 66
            |:.|.|      |:|.:.||||||||.:|...|.:..|::.|:|.|........|.|....|..:
  Rat   198 PAQEAV------VKLRVEGMTCQSCVSSIEGKIRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDL 256

  Fly    67 ASDIDDMGFECSY----------PGD-----------AADPP-------ETPAS-----AWTNIR 98
            ...|.|||||.:.          |.|           ||.||       |||..     |...:|
  Rat   257 RDHICDMGFEAAIKNRTAPLRLGPIDINKLESTNLKRAAVPPIQNSNHLETPGHQQNHLATLPLR 321

  Fly    99 VVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYD------------------------- 138
            :.||.|:|||.|||||||..||:.:|.|.|..|.|:||||                         
  Rat   322 IDGMHCKSCVLNIEGNIGQLPGVQNIHVSLENKTAQVQYDSSCITPLFLQTAIEALPPGYFKVSL 386

  Fly   139 ---------------------------------------------PAQ----------------- 141
                                                         |.:                 
  Rat   387 PDGLEKESGSSSVPSLGSSQRQQEPGPCRTAVLTITGIPRDSSVQPMEDMLSQMKGVQQIDISLA 451

  Fly   142 -------YDPAQIA--EL---IDDMGFEASVQE--------------PRSPSQSPSPAPASSPKK 180
                   |||:.::  ||   ::|||||.||..              |::...||......:...
  Rat   452 EGTGAVLYDPSVVSSDELRTAVEDMGFEVSVNPENITTNRVSSGNSVPQAVGDSPGSVQNMASDT 516

  Fly   181 RATPTPPPPSY------AQNGSAVAIPVEQELLTKCFLHIRGMTCASCVAAIEKHCKKIYGLDSI 239
            |...|...|.|      :..|:|         ..|||:.|:||||||||:.||:..::..|:.|:
  Rat   517 RGLLTHQGPGYLSDSPPSPGGTA---------SQKCFVQIKGMTCASCVSNIERSLQRHAGILSV 572

  Fly   240 LVALLAAKAEVKFNANVVTAENIAKSITELGFPTELIDEPDNGEAEVELEIMGMTCASCVNKIES 304
            ||||::.|||||::..|:.:..||:.|.:|||...::::....|.::||.|.||||||||:.|||
  Rat   573 LVALMSGKAEVKYDPEVIQSPRIAQLIEDLGFEAAIMEDNTVSEGDIELIITGMTCASCVHNIES 637

  Fly   305 HVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKLMTGRDKMAHNYLEHKEEI 369
            .:.:..|:|.|||.|.|.:...::..|..|||.|.:.||.:||.|.| ..|:..|| :|:||.||
  Rat   638 KLTRTNGITYASVALATSKAHVKFDPEIIGPRDIIKVIEEIGFHASL-AHRNPNAH-HLDHKTEI 700

  Fly   370 RKWRNAFLVSLIFGGPCMVAMIYFMLEMSDKGHANMCC---LVPGLSMENLVMFLLSTPVQFFGG 431
            ::|:.:||.||:||.|.|..||| ||..|.|.|..|..   ::||||:.||:.|:|.|.|||.||
  Rat   701 KQWKKSFLCSLVFGIPVMGLMIY-MLIPSSKPHETMVLDHNIIPGLSVLNLIFFILCTFVQFLGG 764

  Fly   432 FHFYVQSYRAIKHGTTNMDVLISMVTTISYVYSVAVVIAAVLLEQNSSPLTFFDTPPMLLIFISL 496
            ::||||:|::::|.:.||||||.:.|||:|.||:.:::.|:..:...||:|||||||||.:||:|
  Rat   765 WYFYVQAYKSLRHKSANMDVLIVLATTIAYAYSLVILVVAIAEKAEKSPVTFFDTPPMLFVFIAL 829

  Fly   497 GRWLEHIAKGKTSEALSKLLSLKAADALLVEISPDFDIISEKVISVDYVQRGDILKVIPGAKVPV 561
            ||||||:||.||||||:||:||:|.:|.:|.:..|..|:.|:.:.::.||||||:||:||.|.||
  Rat   830 GRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLILREEQVPMELVQRGDIIKVVPGGKFPV 894

  Fly   562 DGKVLYGHSSCDESLITGESMPVAKRKGSVVIGGSINQNGVLLVEATHTGENTTLAQIVRLVEEA 626
            |||||.|::..||||||||:|||.|:.||:||.||||.:|.:|::|||.|.:|||||||:|||||
  Rat   895 DGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEA 959

  Fly   627 QTSKAPIQQLADRIAGYFVPFVVVVSSITLIAWIIIGFSNPNLVPVAM-EHKMHMDQNTIIVSYA 690
            |.|||||||||||.:||||||::::|::||:.||||||.:..:|.... ....|:.|..:|:.:|
  Rat   960 QMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIIIGFVDFGIVQKYFPSPSKHISQTEVIIRFA 1024

  Fly   691 FKCALSVLAIACPCALGLATPTAVMVATGTGAINGVLVKGATALENAHKVKTVVFDKTGTITHGT 755
            |:.:::||.|||||:|||||||||||.||..|.||||:||...||.|||:|||:||||||||||.
  Rat  1025 FQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGV 1089

  Fly   756 PMTSKVTLFVTAQVCSLARALTIVGAAEQNSEHPIASAIVHFAKDMLNVGATPQAGSFGKSSHFQ 820
            |...:..|.|.....||.:.|.:||.||.:||||:..|:..:.|:.|.      ..:.|.|:.||
  Rat  1090 PRVMRFLLLVDVATLSLRKVLAVVGTAEASSEHPLGVAVTKYCKEELG------TETLGYSTDFQ 1148

  Fly   821 AVPGCGIRVTVSNYEQTLRQACNADRIINYENLHR---THP--QGSVPVDNGASIEHLLPQRSVR 880
            |||||||...|||.|..|              .||   .||  .|:.|:..|..     ||    
  Rat  1149 AVPGCGISCKVSNVESIL--------------AHRGPTAHPIGVGNPPIGEGTG-----PQ---- 1190

  Fly   881 KSMELNNQQLLSDLVLEPEEELLTDQKIIDSPEILVLIGNREWMERNAIEVPLEISDCMTHEERK 945
                                            ...|||||||||.||.:.:..:|||.||..|.|
  Rat  1191 --------------------------------TFSVLIGNREWMRRNGLTISSDISDAMTDHEMK 1223

  Fly   946 GHTAVLCALNGQLVCMFAVSDMVKPEAHLAVYTLKRMGIDVVLLTGDNKNTAASIAREVGIRTVY 1010
            |.||:|.|::|.|..|.|::|.|||||.||:||||.||:||.|:||||:.||.:||.:|||..|:
  Rat  1224 GQTAILVAIDGVLCGMIAIADAVKPEAALAIYTLKSMGVDVALITGDNRKTARAIATQVGINKVF 1288

  Fly  1011 AEVLPSHKVAKIQRIQANGIRVAMVGDGVNDSPALAQADVGITIAAGTDVAAEASDIVLMRNDLL 1075
            |||||||||||:|.:|..|.:|||||||||||||||||||||.|..|||||.||:|:||:|||||
  Rat  1289 AEVLPSHKVAKVQELQNKGKKVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLL 1353

  Fly  1076 DVVACLDLSRCTVRRIRYNFFFASMYNLLGIPLASGLFAPYGFTLLPWMASVAMAASSVSVVCSS 1140
            ||||.:.||:.||||||.|...|.:||::|||:|:|:|.|.|..|.|||.|.||||||||||.||
  Rat  1354 DVVASIHLSKRTVRRIRVNLVLALIYNMVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSS 1418

  Fly  1141 LLLKMYRKPTAKTLRTAEYEAQLAAERASGSEDEL--DKLSLHRGLDDLPEKGRMPFKRSSTSLI 1203
            |.||.||||..:     .||||     |.|....|  .::|:|.|:||..............|.:
  Rat  1419 LQLKCYRKPDLE-----RYEAQ-----AHGRMKPLSASQVSVHVGMDDRRRDSPRATPWDQVSYV 1473

  Fly  1204 SRIFMHDYGNITSPDAKYGEGLLDPEEQYDGRTK 1237
            |::.:   .::||.......|:.:     ||..|
  Rat  1474 SQVSL---SSLTSDRLSRHGGMAE-----DGGDK 1499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP7NP_001259466.1 HMA 16..78 CDD:238219 24/62 (39%)
HMA 97..159 CDD:238219 36/161 (22%)
HMA 214..274 CDD:238219 29/60 (48%)
ZntA 285..1131 CDD:225127 445/855 (52%)
HMA 287..350 CDD:238219 31/63 (49%)
E1-E2_ATPase 489..735 CDD:278548 147/247 (60%)
COG4087 <984..1085 CDD:226572 72/101 (71%)
Atp7bXP_017455480.1 HMA 120..183 CDD:238219
HMA 205..268 CDD:238219 24/63 (38%)
HMA 320..381 CDD:238219 25/61 (41%)
HMA 418..481 CDD:238219 11/63 (17%)
HMA 545..607 CDD:238219 29/62 (47%)
ZntA 619..1403 CDD:225127 441/848 (52%)
HMA 620..683 CDD:238219 31/63 (49%)
E1-E2_ATPase 822..1069 CDD:278548 147/247 (60%)
COG4087 1238..1357 CDD:226572 85/119 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C346365192
eggNOG 1 0.900 E1_COG2217
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1008 1.000 Inparanoid score I267
OMA 1 1.010
OrthoDB 1 1.010 D33208at33208
OrthoFinder 1 1.000 FOG0002052
OrthoInspector 1 1.000 T619138
orthoMCL 1 0.900 OOG5_126855
Panther 1 1.100 LDO PTHR43520
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.