DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB4 and unpg

Sequence 1:NP_076920.1 Gene:HOXB4 HGNCID:5115 Length:251 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:328 Identity:86/329 (26%)
Similarity:114/329 (35%) Gaps:134/329 (41%)


Human    28 YLPSDHSPGYYAGGQRR------ESSFQPEAGFGRRAACTVQRYAACRDPGPPPPPPPP------ 80
            |.|..|  ||:|....|      ...:.|.:..|..||   |:..|...|.||||.||.      
  Fly    85 YNPWLH--GYFAQNHERLTHLIAGGCYLPSSPAGHPAA---QQPQAQAQPQPPPPHPPTHALEKQ 144

Human    81 -PPPPPPPGLSPRAPAPPPAGALLP---------------------------------------- 104
             ||..|.|..:...|..|.|..:.|                                        
  Fly   145 LPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQA 209

Human   105 EPGQRCEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVYPWMRK---------VHVS-TVNP-NYA 158
            .||.   |....|.||....:|. .|.|||. .||.:...|.:         ..:| |::| ||.
  Fly   210 NPGM---AQLQEPTPPQAHSSPA-KSGSHSP-MEPALDVGMDEDFECSGDSCSDISLTMSPRNYN 269

Human   159 G----------------------------------------------GEPKRSRTAYTRQQVLEL 177
            |                                              .:.:|.|||:|.:|:|||
  Fly   270 GEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLEL 334

Human   178 EKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSG------GAAGS 236
            |:|||..:||:...|.:||.:|.|||.|:||||||||.|||        ::::|      |..|:
  Fly   335 EREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK--------RVKAGLTSHGLGRNGT 391

Human   237 AGG 239
            ..|
  Fly   392 TSG 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB4NP_076920.1 Antp-type hexapeptide 141..146 1/5 (20%)
Homeobox 165..218 CDD:278475 32/53 (60%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.