DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB3 and zen2

Sequence 1:XP_016880049.1 Gene:HOXB3 HGNCID:5114 Length:578 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:155 Identity:58/156 (37%)
Similarity:75/156 (48%) Gaps:39/156 (25%)


Human   332 SAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKA 396
            |..|||:|||::|.||:|||:|||.|:||.|.||:|::..|.|:|||:||||||||||.||....
  Fly    40 SEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNR 104

Human   397 KGLASSSGGPSPAGS-PPQPMQ-----------------STAGFMNALH------SMTPSYE--- 434
            ||...:.....|..| ..:.:|                 .||......|      .:||.|:   
  Fly   105 KGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITPPYQSYD 169

Human   435 -----SPSPPAFGKAHQNAYALPSN 454
                 ||.|.|..:       ||.|
  Fly   170 YLHEFSPEPMALPQ-------LPFN 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB3XP_016880049.1 Homeobox 339..391 CDD:278475 34/52 (65%)
DUF4074 513..576 CDD:290032
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/53 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45664
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.