DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB3 and unpg

Sequence 1:XP_016880049.1 Gene:HOXB3 HGNCID:5114 Length:578 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:553 Identity:141/554 (25%)
Similarity:208/554 (38%) Gaps:146/554 (26%)


Human    25 PALKARVQLGARRARGSRSPARPGRSGSFSGNWRLPRPECQIRALLGPWRPNKAGGGGGGGVGAS 89
            |||....::|...:..:|..::|           .|:| ..|.:|:....|            |:
  Fly     4 PALLQNGEIGTMESPTTRLASKP-----------FPKP-FSIESLIANQTP------------AT 44

Human    90 ASGPLP--------------QLGG---TLGGCWGLLRVERLGCGWL-------RRRSPSLGRGSG 130
            |:.|.|              :|..   ......||.:.. |...||       ..|...|..|..
  Fly    45 ATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQFP-LYNPWLHGYFAQNHERLTHLIAGGC 108

Human   131 AWQSAPA---RTQRPAARRCPRPSGRPH-----RRGDLSPAARSGARCEYILCLPVLPSSVAKAA 187
            ...|:||   ..|:|.|:..|:|. .||     ....|.|.........:   ||..|::...|.
  Fly   109 YLPSSPAGHPAAQQPQAQAQPQPP-PPHPPTHALEKQLPPTLPHPLDTRF---LPFNPAAAGVAP 169

Human   188 THLEGDYQRSA--CSLQSLGNAAPHAK------SKELNGSCMRPGLAPEPLSAPPGSPPPSAAPT 244
            |.|  .|:|.|  .:...:.:.:.||:      :..::.....||:|  .|..|   .||.|..:
  Fly   170 TDL--SYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMA--QLQEP---TPPQAHSS 227

Human   245 SATSNSSNGGGPS----KSGPPKCGPGTNSTLTKQIFP-----WMKESRQTSKLKNNSPGTAEGC 300
            .|.|.|.:...|:    .....:|...:.|.::..:.|     .|.:||..:...::|    |.|
  Fly   228 PAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDS----EDC 288

Human   301 GGGGGGGG---GGGSGGSGGGGGGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCR 362
            ....|...   |||.||....|.|.....|       |:|.|||:||.||:|||:|||..:||..
  Fly   289 SDDEGAQSRHEGGGMGGKDSQGNGSSSNSK-------SRRRRTAFTSEQLLELEREFHAKKYLSL 346

Human   363 PRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALH 427
            ..|.::|..|.|||.|:||||||||.|:|: .|| ||.|...|.:         .:|:|....: 
  Fly   347 TERSQIATSLKLSEVQVKIWFQNRRAKWKR-VKA-GLTSHGLGRN---------GTTSGTKIVV- 399

Human   428 SMTPSYESPSPPAFGKAHQNAYALPSNYQPPLKGCGAPQKYPPTPAPEYEPHV-LQANG------ 485
                    |.|     .|.|.:|:.|.:|...|.|.:      .|.|:....: .:|.|      
  Fly   400 --------PIP-----VHVNRFAVRSQHQQLEKMCLS------GPKPDLRKKLSAEAIGGFEKFS 445

Human   486 GAYGTPTMQGSPVYVGGG---------GYADPL 509
            |:....:..|.||.:|.|         |.:.||
  Fly   446 GSTNASSPSGGPVGLGVGVGVGVGVGLGVSTPL 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB3XP_016880049.1 Homeobox 339..391 CDD:278475 31/52 (60%)
DUF4074 513..576 CDD:290032
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/51 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.