DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FucT6 and Fut8

Sequence 1:NP_572740.1 Gene:FucT6 FlyBaseID:FBgn0030327 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001239543.1 Gene:Fut8 MGIID:1858901 Length:575 Species:Mus musculus

Alignment Length:613 Identity:285/614 (46%)
Similarity:393/614 (64%) Gaps:51/614 (8%)


  Fly    10 ASANSWARALIIFVLAWIGLVYVFVVKLTNTQGQQAAGESELNARRISQALQMLEHTRQRNEELK 74
            |...|| |.:::.:.||..|::.....|....     ...:.::|.:|:.|..||..:|:||:|:
Mouse     3 AWTGSW-RWIMLILFAWGTLLFYIGGHLVRDN-----DHPDHSSRELSKILAKLERLKQQNEDLR 61

  Fly    75 QLIDELMSDQ--LDKQSAMKLVQRLENDALNPKLAPEVAGPEPESMFESAPADLRGWNNVAEGAP 137
            ::.:.|...:  :|:.:|...|:.||...:..|...|                     |..:.|.
Mouse    62 RMAESLRIPEGPIDQGTATGRVRVLEEQLVKAKEQIE---------------------NYKKQAR 105

  Fly   138 NDLEAGVPDHGEFEPSLEYEFTRRRIQTNIGEIWNFFSSELGKVRKAVAAGHASA-DLEESINQV 201
            |.|            ..::|..||||:....|:|.|..|||.|::      |... :|:...:::
Mouse   106 NGL------------GKDHEILRRRIENGAKELWFFLQSELKKLK------HLEGNELQRHADEI 152

  Fly   202 LLQGAEHKRSLLSDMERMRQSDGYEAWRHKEARDLSDLVQRRLHHLQNPSDCQNARKLVCKLNKG 266
            ||....|:||:::|:..:.|:||...||.|||:||::|||||:.:||||.||..||||||.:|||
Mouse   153 LLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKARKLVCNINKG 217

  Fly   267 CGYGCQLHHVVYCFIVAYATERTLILKSRGWRYHKGGWEEVFQPVSNSCHDAGTANTYNWPGK-- 329
            ||||||||||||||::||.|:|||||:|:.|||..||||.||:|||.:|.|....:|.:|.|:  
Mouse   218 CGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGLSTGHWSGEVN 282

  Fly   330 -PNTQVLVLPIIDSLMPRPPYLPLAVPEDLAPRLKRLHGDPIVWWVGQFLKYLLRPQPTTRDFLT 393
             .|.||:.|||:|||.|||||||||||||||.||.|:||||.||||.||:|||:||||.....:.
Mouse   283 DKNIQVVELPIVDSLHPRPPYLPLAVPEDLADRLLRVHGDPAVWWVSQFVKYLIRPQPWLEKEIE 347

  Fly   394 SGMRNLGWERPIVGVHVRRTDKVGTEAACHSVEEYMTYVEDYYRTLEVNGSTVARRIFLASDDAQ 458
            ...:.||::.|::|||||||||||||||.|.:||||.:||::::.|........:|::||:||..
Mouse   348 EATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPT 412

  Fly   459 VIEEARRKYPQYQIIGDPEVARMASVSTRYTDTALNGIILDIHLLSMSDHLVCTFSSQVCRVAYE 523
            :::||:.||..|:.|.|..::..|.:..|||:.:|.|:|||||.||.:|.|||||||||||||||
Mouse   413 LLKEAKTKYSNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYE 477

  Fly   524 IMQTMYPDAAHRFKSLDDIYYYGGQNAHNRRVVIAHKPRTHEDLQLRVGDLVSVAGNHWDGNSKG 588
            ||||::|||:..|.|||||||:|||||||:..|..|||||.|::.:..||::.||||||||.|||
Mouse   478 IMQTLHPDASANFHSLDDIYYFGGQNAHNQIAVYPHKPRTEEEIPMEPGDIIGVAGNHWDGYSKG 542

  Fly   589 KNTRTNQGGLFPSFKVEEKVDTAKLPLY 616
            .|.:..:.||:||:||.||::|.|.|.|
Mouse   543 INRKLGKTGLYPSYKVREKIETVKYPTY 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FucT6NP_572740.1 Fut8_like 223..545 CDD:211386 195/325 (60%)
SH3_Fut8 552..606 CDD:212726 28/54 (52%)
Fut8NP_001239543.1 Fut8_like 174..499 CDD:211386 195/325 (60%)
SH3-binding. {ECO:0000255} 299..305 6/6 (100%)
Important for donor substrate binding 365..366 1/1 (100%)
SH3_Fut8 506..560 CDD:212726 28/54 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143549732
eggNOG 1 0.900 E1_KOG3705
Hieranoid 1 1.000
Homologene 1 1.000 H9650
Inparanoid 1 1.050 561 1.000 Inparanoid score I1079
Isobase 1 0.950 0 Normalized mean entropy S3633
OMA 1 1.010
OrthoDB 1 1.010 D1290594at2759
OrthoFinder 1 1.000 FOG0004775
OrthoInspector 1 1.000 T1085283
orthoMCL 1 0.900 OOG5_132113
Panther 1 1.100 LDO PTHR13132
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3276
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.