DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FucT6 and FUT8

Sequence 1:NP_572740.1 Gene:FucT6 FlyBaseID:FBgn0030327 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_016876625.1 Gene:FUT8 HGNCID:4019 Length:609 Species:Homo sapiens

Alignment Length:642 Identity:280/643 (44%)
Similarity:391/643 (61%) Gaps:83/643 (13%)


  Fly    14 SWARALIIFVLAWIGLVYVFVVKLTNTQGQQAAGESELNARRISQALQMLEHTRQRNEELKQLID 78
            || |.:::.:.||..|::.....|....     ...:.::|.:|:.|..||..:|:||:|:::.:
Human     7 SW-RWIMLILFAWGTLLFYIGGHLVRDN-----DHPDHSSRELSKILAKLERLKQQNEDLRRMAE 65

  Fly    79 ELMSDQ--LDKQSAMKLVQRLENDALNPKLAPEVAGPEPESMFESAPADLRGWNNVAEGAPNDLE 141
            .|...:  :|:..|:..|:.||...:..|...|                     |..:...|.| 
Human    66 SLRIPEGPIDQGPAIGRVRVLEEQLVKAKEQIE---------------------NYKKQTRNGL- 108

  Fly   142 AGVPDHGEFEPSLEYEFTRRRIQTNIGEIWNFFSSELGKVRKAVAAGHASADLEESINQVLLQGA 206
                       ..::|..||||:....|:|.|..|||.|::..     ...:|:...::.||...
Human   109 -----------GKDHEILRRRIENGAKELWFFLQSELKKLKNL-----EGNELQRHADEFLLDLG 157

  Fly   207 EHKR----------------------------------SLLSDMERMRQSDGYEAWRHKEARDLS 237
            .|:|                                  |:::|:..:.|:||...||.|||:||:
Human   158 HHERILMAITVSLVNNKRKIVVLAQPTTVKRKRITPYKSIMTDLYYLSQTDGAGDWREKEAKDLT 222

  Fly   238 DLVQRRLHHLQNPSDCQNARKLVCKLNKGCGYGCQLHHVVYCFIVAYATERTLILKSRGWRYHKG 302
            :|||||:.:||||.||..|:||||.:|||||||||||||||||::||.|:|||||:|:.|||..|
Human   223 ELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATG 287

  Fly   303 GWEEVFQPVSNSCHDAGTANTYNWPGK---PNTQVLVLPIIDSLMPRPPYLPLAVPEDLAPRLKR 364
            |||.||:|||.:|.|....:|.:|.|:   .|.||:.|||:|||.|||||||||||||||.||.|
Human   288 GWETVFRPVSETCTDRSGISTGHWSGEVKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVR 352

  Fly   365 LHGDPIVWWVGQFLKYLLRPQPTTRDFLTSGMRNLGWERPIVGVHVRRTDKVGTEAACHSVEEYM 429
            :||||.||||.||:|||:||||.....:....:.||::.|::|||||||||||||||.|.:||||
Human   353 VHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYM 417

  Fly   430 TYVEDYYRTLEVNGSTVARRIFLASDDAQVIEEARRKYPQYQIIGDPEVARMASVSTRYTDTALN 494
            .:||::::.|........:|::||:||..:::||:.|||.|:.|.|..::..|.:..|||:.:|.
Human   418 VHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLR 482

  Fly   495 GIILDIHLLSMSDHLVCTFSSQVCRVAYEIMQTMYPDAAHRFKSLDDIYYYGGQNAHNRRVVIAH 559
            |:|||||.||.:|.|||||||||||||||||||::|||:..|.|||||||:|||||||:..:.||
Human   483 GVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAH 547

  Fly   560 KPRTHEDLQLRVGDLVSVAGNHWDGNSKGKNTRTNQGGLFPSFKVEEKVDTAKLPLY 616
            :|||.:::.:..||::.||||||||.|||.|.:..:.||:||:||.||::|.|.|.|
Human   548 QPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTY 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FucT6NP_572740.1 Fut8_like 223..545 CDD:211386 195/325 (60%)
SH3_Fut8 552..606 CDD:212726 26/54 (48%)
FUT8XP_016876625.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143547281
eggNOG 1 0.900 E1_KOG3705
Hieranoid 1 1.000
Homologene 1 1.000 H9650
Inparanoid 1 1.050 560 1.000 Inparanoid score I1082
Isobase 1 0.950 0 Normalized mean entropy S3633
OMA 1 1.010
OrthoDB 1 1.010 D1290594at2759
OrthoFinder 1 1.000 FOG0004775
OrthoInspector 1 1.000 T1075178
orthoMCL 1 0.900 OOG5_132113
Panther 1 1.100 LDO PTHR13132
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3276
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.