DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and lok

DIOPT Version :10

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster


Alignment Length:293 Identity:94/293 - (32%)
Similarity:158/293 - (53%) Gaps:25/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DLLPD------KDAAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIID----LGATTES 62
            ||.|:      ::..|.:|...:    ||.|....||...:..|.::||.||:.    .||...:
  Fly   157 DLSPNESIGLPEEINKTYYVNRK----LGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPST 217

  Fly    63 GETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSE 127
            ..::|..:|    .|..|::. :.||.::.:.|:.:....|::|.|....|:|.:.:.|...|||
  Fly   218 NFSDPDRVL----NEAKIMKN-LSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSE 277

  Fly   128 KKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCG 189
            ..::....|:...|:|:|.:.|.||||||:|:||   ||...:|::|||.:|.:|:...:..|||
  Fly   278 DISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCG 342

  Fly   190 TPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTS 254
            ||.|:|||.|   :..|...|:::||||:.||::||.|.|..||.........:.|.:|::::..
  Fly   343 TPLYVAPEVL---ITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGH 404

  Fly   255 PEWADISEDPKDLIRKCLVVDPSQRITVKEVLR 287
            |.|..:|:..|.||.:.|:|||.:|.::.:||:
  Fly   405 PSWKSVSQRAKLLINQMLIVDPERRPSIDDVLQ 437

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 90/276 (33%)