DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB2 and zen2

DIOPT Version :9

Sequence 1:NP_002136.1 Gene:HOXB2 / 3212 HGNCID:5113 Length:356 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:226 Identity:77/226 - (34%)
Similarity:104/226 - (46%) Gaps:41/226 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   143 ARRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREP 207
            ::|.|||:::.||:|||:|||.||||.|.||:||:..|.|||||||:||||||||.|:.| :|:.
  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKST-NRKG 106

Human   208 PDGE-----PACPGALEDI--CDPAEEPAASPGGPSASRAAWEACCH----PPEVVPGALSAD-- 259
            ..|.     |....:.||:  .|...|........:...|......|    ..::.|...|.|  
  Fly   107 AIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITPPYQSYDYL 171

Human   260 ----PRPLAV------RLEGAGASSPGCALRGAGGLEPG-PLPEDVFS-GRQDSPFLPDLNFFAA 312
                |.|:|:      ..:...|||       ..||||. |:.|:|.. ..||.|.:.:   |..
  Fly   172 HEFSPEPMALPQLPFNEFDANWASS-------WLGLEPTIPIAENVIEHNTQDQPMIQN---FCW 226

Human   313 DSCLQLSGGLSPSLQGSLDSPVPFSEEELDF 343
            |     |...|.|....||....|.:..|:|
  Fly   227 D-----SNSSSASSSDILDVDYDFIQNLLNF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB2NP_002136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..142
Antp-type hexapeptide 94..99
Homeobox 147..199 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..240 10/49 (20%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.