DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA3 and rpa3

DIOPT Version :8

Sequence 1:NP_001285131.1 Gene:RPA3 / 32113 FlyBaseID:FBgn0266421 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_956521.1 Gene:rpa3 / 393196 ZFINID:ZDB-GENE-040426-977 Length:121 Species:Danio rerio

Alignment Length:99 Identity:26/100 (26%)
Similarity:42/100 (42%) Gaps:3/100 (3%)


  Fly     6 PRSIINGGMLKQFSGQTVSIMVRVESV--AGSTLLASSTDNHKLKINLPGELGAAEGAWVEVIGV 68
            |::.||..||.|:..:.|..:.|:|.|  :|..|.....:.....:.|...|.......||:||.
Zfish     8 PKTRINTSMLSQYISRPVCFVGRLEKVHPSGKVLTLVDGEGKSASVELNEPLDEELSGIVEIIGT 72

  Fly    69 PHGADTLRAKEVIEFGGENIDFDKDGYN-GLSHL 101
            ......:.|....::..:.:.||.:.|| ||..|
Zfish    73 LSNKGAIMATSYTQYREDKVPFDLELYNEGLKVL 106

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RPA3NP_001285131.1 Rep_fac-A_3 1..109 CDD:285824 26/100 (26%)
rpa3NP_956521.1 Rep_fac-A_3 6..113 CDD:285824 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1594928at2759
OrthoFinder 1 1.000 FOG0007734
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15114
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.