DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA3 and rpa3

DIOPT Version :10

Sequence 1:NP_572737.1 Gene:RPA3 / 32113 FlyBaseID:FBgn0288833 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_956521.1 Gene:rpa3 / 393196 ZFINID:ZDB-GENE-040426-977 Length:121 Species:Danio rerio


Alignment Length:99 Identity:26/99 - (26%)
Similarity:42/99 - (42%) Gaps:3/99 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PRSIINGGMLKQFSGQTVSIMVRVESV--AGSTLLASSTDNHKLKINLPGELGAAEGAWVEVIGV 68
            |::.||..||.|:..:.|..:.|:|.|  :|..|.....:.....:.|...|.......||:||.
Zfish     8 PKTRINTSMLSQYISRPVCFVGRLEKVHPSGKVLTLVDGEGKSASVELNEPLDEELSGIVEIIGT 72

  Fly    69 PHGADTLRAKEVIEFGGENIDFDKDGYN-GLSHL 101
            ......:.|....::..:.:.||.:.|| ||..|
Zfish    73 LSNKGAIMATSYTQYREDKVPFDLELYNEGLKVL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA3NP_572737.1 Rep_fac-A_3 1..109 CDD:462551 26/99 (26%)
rpa3NP_956521.1 RPA3 8..113 CDD:239925 26/99 (26%)

Return to query results.
Submit another query.