powered by:
Protein Alignment RPA3 and rpa3
DIOPT Version :9
| Sequence 1: | NP_001285131.1 |
Gene: | RPA3 / 32113 |
FlyBaseID: | FBgn0266421 |
Length: | 112 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_956521.1 |
Gene: | rpa3 / 393196 |
ZFINID: | ZDB-GENE-040426-977 |
Length: | 121 |
Species: | Danio rerio |
| Alignment Length: | 99 |
Identity: | 26/99 - (26%) |
| Similarity: | 42/99 - (42%) |
Gaps: | 3/99 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 PRSIINGGMLKQFSGQTVSIMVRVESV--AGSTLLASSTDNHKLKINLPGELGAAEGAWVEVIGV 68
|::.||..||.|:..:.|..:.|:|.| :|..|.....:.....:.|...|.......||:||.
Zfish 8 PKTRINTSMLSQYISRPVCFVGRLEKVHPSGKVLTLVDGEGKSASVELNEPLDEELSGIVEIIGT 72
Fly 69 PHGADTLRAKEVIEFGGENIDFDKDGYN-GLSHL 101
......:.|....::..:.:.||.:.|| ||..|
Zfish 73 LSNKGAIMATSYTQYREDKVPFDLELYNEGLKVL 106
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1594928at2759 |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007241 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103793 |
| Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR15114 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
5 | 5.010 |
|
Return to query results.
Submit another query.