DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA3 and rpa3

DIOPT Version :9

Sequence 1:NP_001285131.1 Gene:RPA3 / 32113 FlyBaseID:FBgn0266421 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_956521.1 Gene:rpa3 / 393196 ZFINID:ZDB-GENE-040426-977 Length:121 Species:Danio rerio


Alignment Length:99 Identity:26/99 - (26%)
Similarity:42/99 - (42%) Gaps:3/99 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PRSIINGGMLKQFSGQTVSIMVRVESV--AGSTLLASSTDNHKLKINLPGELGAAEGAWVEVIGV 68
            |::.||..||.|:..:.|..:.|:|.|  :|..|.....:.....:.|...|.......||:||.
Zfish     8 PKTRINTSMLSQYISRPVCFVGRLEKVHPSGKVLTLVDGEGKSASVELNEPLDEELSGIVEIIGT 72

  Fly    69 PHGADTLRAKEVIEFGGENIDFDKDGYN-GLSHL 101
            ......:.|....::..:.:.||.:.|| ||..|
Zfish    73 LSNKGAIMATSYTQYREDKVPFDLELYNEGLKVL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA3NP_001285131.1 Rep_fac-A_3 1..109 CDD:400821 26/99 (26%)
rpa3NP_956521.1 Rep_fac-A_3 6..113 CDD:285824 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594928at2759
OrthoFinder 1 1.000 - - FOG0007241
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103793
Panther 1 1.100 - - LDO PTHR15114
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.