DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11696 and CG11902

Sequence 1:NP_572731.1 Gene:CG11696 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_651389.3 Gene:CG11902 FlyBaseID:FBgn0028647 Length:1426 Species:Drosophila melanogaster

Alignment Length:834 Identity:148/835 (18%)
Similarity:233/835 (28%) Gaps:369/835 (44%)


  Fly     2 ICRLCLEDAEHGVPIFG-QEPPMGQPAHRQLAELIERHLLLVLAEN--DVVSTCLCNRCWRQLAE 63
            :||.|.......:|:.. .:....:..:..|.||.:..|     ||  |.:...:|:.|||::..
  Fly     6 VCRTCAVQNSQLLPLSTCLDKDSSKSYYAVLQELTQIDL-----ENTDDNLPQHICSECWRRMES 65

  Fly    64 IEQFCSMVAEKQRSLHRSL--QLKTELPELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHIL 126
            ...|    .::.|.:|..|  ||:..|.|||             .:.|.|..:..|         
  Fly    66 AYTF----VQQARKVHGELLAQLRECLDELP-------------IDIPAEQNIKTE--------- 104

  Fly   127 CEPVIDALSAGDEKDSDYGDT----FEPDFEPESQPDEE--EEPEPDPVKPRPRGRPRKTALQQT 185
                :|....|::.:.:..||    .|..::|.|..|.|  ..||.|                 .
  Fly   105 ----VDLDDGGNKSEVEVDDTEATALELKWQPASGSDREFCSGPESD-----------------E 148

  Fly   186 HQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDA 250
            .|:.|:.|..|:...|.|                              ...|.|.:   |..|  
  Fly   149 DQVEKKSYHLRRSSRKVK------------------------------HPVESENE---ECKP-- 178

  Fly   251 DEQPKP-RGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLEDFND 314
             .:|.| :.:||||..               |.|..:       :..:.:..|.:|......:.|
  Fly   179 -SEPSPVKRRRGRPPG---------------PAKSQA-------MTTDGRHACEVCGKTFSWYRD 220

  Fly   315 LKRHFRVEHDCTGYVKC--CNNRYKKRTLYVDHLHCHKDPQY----------------------- 354
            ::||.|:..:...|| |  |...:.::..|:.||.|||..:.                       
  Fly   221 MQRHARIHFENASYV-CDTCGKGFLRKDKYIFHLRCHKKREAKWKALQLGKEWRFAERLYSSGKL 284

  Fly   355 ---------FSCQ---------------------------------------------------- 358
                     .|||                                                    
  Fly   285 KRIECKLCGLSCQRMEELRAHLWDHADTETLVNLRTDSDVVREHFPGLPCDLDNIKKQICVDIAD 349

  Fly   359 ------SCRKNF-----------------------------LNRNSQVM-HMLRFHSQQQELV-- 385
                  :|..||                             .||..::| |.|..|||....:  
  Fly   350 GHLEKYACVVNFHGYELGLSDSDEECDSKESKYHCFVCNMSFNRKHRLMKHTLEDHSQSATTLPW 414

  Fly   386 HQCAICEARF--------------------------AKKFLLTMHLKGHKGTERPE-------VC 417
            .:|:.|:..|                          :.:|:...:|:.|..:.|.|       :|
  Fly   415 QRCSSCKVGFLCLTMYNKHLNTHCQSKIRRYRCRKCSGRFMWPENLQRHACSHREEKTIASQILC 479

  Fly   418 DTCSKTFRTKFELSAH-VKRMH---------------------------------AADF------ 442
            ..|..:..:..:|..| :...|                                 |.||      
  Fly   480 SLCDISLSSLSQLRLHLITHQHDLNGISPEYNSLFFRSFYPDGLNCSISDLAVRIAEDFEVQDFD 544

  Fly   443 -----------------------------TPIICDICGTHFRSKANFLIHKKALHPDGPVAEV-- 476
                                         |..||.:||....|..|.:.|:..||.|| |||:  
  Fly   545 RYYNASTESGQELDLFESETELSDEETSKTSHICLLCGETSNSLMNLMKHQICLHSDG-VAELPC 608

  Fly   477 QCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRH------ 535
            :|..||.....:..|::| .||......:::.|.:||......:....|.:.||:..:.      
  Fly   609 RCDYCGSGFVSKALLQQH-RRHRCEKKHSRFHCRICNIRFIWESNYEKHEKTHHNKTKDAEERPT 672

  Fly   536 --KCSLCDKEFKLPRALAEHMATH--TGIDLYQCQFCTRTF------KSHANMH 579
              ||..|:|.|...:.|..|...|  .....:.|..|.|.|      |||..:|
  Fly   673 KLKCDQCEKVFIWHKDLNRHKRLHQPQSAAQFDCPHCHRRFHRKDGLKSHLKVH 726

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 17/79 (22%)
C2H2 Zn finger 332..349 CDD:275368 5/17 (29%)
C2H2 Zn finger 357..378 CDD:275368 10/109 (9%)
C2H2 Zn finger 388..408 CDD:275368 5/46 (11%)
C2H2 Zn finger 417..438 CDD:275368 4/22 (18%)
C2H2 Zn finger 447..465 CDD:275368 6/18 (33%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
C2H2 Zn finger 509..529 CDD:275368 4/20 (20%)
C2H2 Zn finger 537..557 CDD:275368 6/20 (30%)
C2H2 Zn finger 565..583 CDD:275368 8/22 (36%)
CG11902NP_651389.3 zf-AD 6..83 CDD:285071 19/86 (22%)
C2H2 Zn finger 208..228 CDD:275368 6/20 (30%)
C2H2 Zn finger 236..256 CDD:275368 6/20 (30%)
C2H2 Zn finger 384..405 CDD:275368 5/21 (24%)
C2H2 Zn finger 417..437 CDD:275368 3/20 (15%)
C2H2 Zn finger 447..463 CDD:275368 2/16 (13%)
C2H2 Zn finger 578..599 CDD:275368 7/21 (33%)
C2H2 Zn finger 610..629 CDD:275368 6/20 (30%)
C2H2 Zn finger 640..660 CDD:275368 4/20 (20%)
C2H2 Zn finger 676..696 CDD:275368 6/20 (30%)
C2H2 Zn finger 706..726 CDD:275368 7/20 (35%)
C2H2 Zn finger 762..782 CDD:275368
C2H2 Zn finger 866..887 CDD:275368
C2H2 Zn finger 896..918 CDD:275368
C2H2 Zn finger 926..947 CDD:275368
C2H2 Zn finger 967..987 CDD:275368
C2H2 Zn finger 996..1016 CDD:275368
C2H2 Zn finger 1044..1063 CDD:275368
C2H2 Zn finger 1224..1244 CDD:275368
C2H2 Zn finger 1271..1291 CDD:275368
zf-H2C2_2 1283..1306 CDD:290200
COG5048 1295..>1367 CDD:227381
C2H2 Zn finger 1299..1319 CDD:275368
zf-H2C2_2 1311..1336 CDD:290200
C2H2 Zn finger 1327..1347 CDD:275368
zf-H2C2_2 1340..1364 CDD:290200
C2H2 Zn finger 1355..1375 CDD:275368
zf-H2C2_2 1367..1392 CDD:290200
C2H2 Zn finger 1383..1401 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133940308
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.