DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11696 and CG6654

Sequence 1:NP_572731.1 Gene:CG11696 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster

Alignment Length:665 Identity:161/666 (24%)
Similarity:237/666 (36%) Gaps:156/666 (23%)


  Fly    31 LAELIERHLLLVLAENDVVSTCLCNRCWRQLAEIEQFCSMVAEKQRSLHRSLQLKTELPELPE-- 93
            ||::|..........||.:...:|..|..:::....|........|:| |.| |...|||.|:  
  Fly    29 LADMIREFTKTKPRRNDNLPEKVCLSCLSEISNCYTFKIKCENSSRTL-RQL-LPNALPEEPDSK 91

  Fly    94 --------LTEPEPALVVW---------------------NT---ESPIEPKLSYEGD-DIKDHI 125
                    .|:.......|                     ||   :|.|...|.|||: ::.|:.
  Fly    92 VSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTTDAEQNTSLIKSTISVDLDYEGEGEVFDYE 156

  Fly   126 L-CEPVIDALS--------AGDEKDSDYGDT---FE-PDFEPESQPDE---------EEEPEPDP 168
            | .|||....|        ..|||:..:..|   :| .|.|.|.|..|         :.|.|...
  Fly   157 LPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDHELEQQIRECNLAIFEGVDNEAEIIT 221

  Fly   169 VKPRPRGRPRKTALQ-------QTHQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGA 226
            | ..|:...||:|.:       ..||......|:.::..|.::.:.:.|.||.|         |.
  Fly   222 V-TAPQVTTRKSAAKLLTQQENDKHQTPVGSKEEARELEKEQVPQSAKRTSRRR---------GV 276

  Fly   227 EDDQDGDEDEEDEEDVGGELTPDADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMD 291
            .           ::||  ..||.:|.:|.|  |:.|..|::.::| ....|...|...|......
  Fly   277 V-----------KQDV--PATPPSDAEPSP--KQHRLGTQRKLSA-PRAGTVNGPSTTSGAATTP 325

  Fly   292 DYIAANVKLDCAICAAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFS 356
            :     :|..|..|.|.......|..|.|.:       .|.|..||                   
  Fly   326 E-----LKYHCDRCNAGFAVEKSLMIHRRQK-------GCINRNYK------------------- 359

  Fly   357 CQSCRKNFLNRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHL-KGHKGTERPEVCDTC 420
            |..|.|.|::.:....|      |.....|.|..|..|...|..|:.|: :|||...|.: |:.|
  Fly   360 CNECEKVFVSPDHLAEH------QASHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRNQ-CNIC 417

  Fly   421 SKTFRTKFELSAHVKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWL 485
            .|.|.....|..|: |:|..: .|.:|:|||..|...||...| |..|.:  ....:|.||....
  Fly   418 QKVFTMLSTLRDHM-RIHTGE-KPFVCNICGKSFTQNANLRQH-KLRHSE--TKSFKCELCPHSF 477

  Fly   486 RDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRAL 550
            ..:..|..|...|   .||..:.|.:|.|..::..:|:.|.|.|...:.:.|.||...|.....|
  Fly   478 VTKAELTSHARTH---TGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVL 539

  Fly   551 AEHMATHTGIDLYQCQFCTRTFKSHANMHNHKKKMHPNDWVRKYSQPSSSITSTAAPLAHPNHPN 615
            ..|..||||...|.|.||::||....:...| ::.|..:  |.|          ..|:.:....:
  Fly   540 KNHRRTHTGERPYVCPFCSKTFTQRGDCQMH-QRTHQGE--RIY----------ICPVCNEEFKS 591

  Fly   616 QPAPPAAAPTNLAGH 630
            .|    ...::||||
  Fly   592 MP----EMRSHLAGH 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 9/47 (19%)
C2H2 Zn finger 332..349 CDD:275368 3/17 (18%)
C2H2 Zn finger 357..378 CDD:275368 5/21 (24%)
C2H2 Zn finger 388..408 CDD:275368 7/21 (33%)
C2H2 Zn finger 417..438 CDD:275368 7/21 (33%)
C2H2 Zn finger 447..465 CDD:275368 8/18 (44%)
C2H2 Zn finger 478..498 CDD:275368 5/20 (25%)
C2H2 Zn finger 509..529 CDD:275368 6/20 (30%)
C2H2 Zn finger 537..557 CDD:275368 7/20 (35%)
C2H2 Zn finger 565..583 CDD:275368 6/18 (33%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 11/51 (22%)
C2H2 Zn finger 331..354 CDD:275368 7/30 (23%)
COG5048 <357..570 CDD:227381 69/247 (28%)
C2H2 Zn finger 360..380 CDD:275368 6/26 (23%)
C2H2 Zn finger 385..406 CDD:275370 7/21 (33%)
C2H2 Zn finger 414..434 CDD:275368 7/21 (33%)
zf-H2C2_2 427..451 CDD:290200 10/26 (38%)
C2H2 Zn finger 442..490 CDD:275368 15/51 (29%)
C2H2 Zn finger 470..487 CDD:275368 5/17 (29%)
zf-H2C2_2 482..507 CDD:290200 8/28 (29%)
C2H2 Zn finger 498..518 CDD:275368 6/20 (30%)
zf-H2C2_2 510..534 CDD:290200 8/24 (33%)
C2H2 Zn finger 526..546 CDD:275368 7/20 (35%)
zf-H2C2_2 539..563 CDD:290200 12/24 (50%)
C2H2 Zn finger 554..574 CDD:275368 6/21 (29%)
C2H2 Zn finger 582..602 CDD:275368 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.