DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11696 and CG17359

Sequence 1:NP_572731.1 Gene:CG11696 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster

Alignment Length:483 Identity:92/484 (19%)
Similarity:155/484 (32%) Gaps:177/484 (37%)


  Fly     2 ICRLCLEDAEHGVPIFGQEPPMGQPAHRQ---LAELIERHLLLVLAENDVVSTCLCNRCWRQLAE 63
            :||:|.::::..:.|:.:..........|   ||.::.......:.:.|.:...:|..|    ||
  Fly     6 MCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVEC----AE 66

  Fly    64 IEQFCSMVAEKQRSLHRSL-QLKTELPELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHILC 127
            ..:....:..:.|..|:.. ||:..:.||.::   |..|   |....|||::.            
  Fly    67 AVRNAYRLRRQCRKSHQYFEQLRLMMKELDDI---EYCL---NIGDNIEPQMP------------ 113

  Fly   128 EPVIDALSAGDEKDSDYGDTFEP--------DFEPESQPDEEEEPEPDPV-KPRPRGRPRKTALQ 183
               :..:.||...     :|.||        .:.|         |||.|: .|.|.....|  |.
  Fly   114 ---VSVMEAGKTP-----ETSEPLLVELVQVKYMP---------PEPKPISSPLPDNNEHK--LA 159

  Fly   184 QTHQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTP 248
            |::...|..:.|.|                      :|:.:.:::|....:.|.:.||       
  Fly   160 QSYSPAKTPHNKSK----------------------RRARSYSDNDSWSPDSELEHED------- 195

  Fly   249 DADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLEDFN 313
              |::.....|||:||                                                 
  Fly   196 --DDKIWNASKRGKPK------------------------------------------------- 209

  Fly   314 DLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFH 378
                  ||                              |..:.|:.|.::|..:.:..:|| |.|
  Fly   210 ------RV------------------------------PGPYRCKLCTQSFTQKQNLEIHM-RIH 237

  Fly   379 SQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFT 443
            :.::.  ::|::|...||:|..|..|.:.|.| |||..|..|.|.||...:|..|. |.|..: .
  Fly   238 TGERP--YKCSLCPRSFAQKGNLQSHTRCHTG-ERPFGCPNCPKRFRQVGQLQVHT-RTHTGE-Q 297

  Fly   444 PIICDICGTHFRSKANFLIHKKALHPDG 471
            |..|..|...|:.......|..| |..|
  Fly   298 PFKCSKCQQSFKQLNGLQKHMSA-HTRG 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 13/79 (16%)
C2H2 Zn finger 332..349 CDD:275368 0/17 (0%)
C2H2 Zn finger 357..378 CDD:275368 6/21 (29%)
C2H2 Zn finger 388..408 CDD:275368 7/20 (35%)
C2H2 Zn finger 417..438 CDD:275368 8/21 (38%)
C2H2 Zn finger 447..465 CDD:275368 4/18 (22%)
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 15/86 (17%)
zf-C2H2 215..237 CDD:278523 6/23 (26%)
C2H2 Zn finger 217..237 CDD:275368 6/21 (29%)
zf-H2C2_2 229..254 CDD:290200 8/28 (29%)
C2H2 Zn finger 245..265 CDD:275368 7/20 (35%)
zf-H2C2_2 257..282 CDD:290200 12/26 (46%)
C2H2 Zn finger 273..293 CDD:275368 8/21 (38%)
zf-H2C2_2 286..310 CDD:290200 8/26 (31%)
C2H2 Zn finger 301..321 CDD:275368 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.