DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11696 and CG12391

Sequence 1:NP_572731.1 Gene:CG11696 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_610639.1 Gene:CG12391 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster

Alignment Length:657 Identity:141/658 (21%)
Similarity:228/658 (35%) Gaps:205/658 (31%)


  Fly    86 TELPELPELTEPEPALVVWNTESPIEPKLSYEG------DD--------IKDHILCEPVIDALSA 136
            |.|.|........|.....|.|.| :|:....|      ||        |.|::     .|...|
  Fly     6 TPLAETNGEQRQNPQESAQNQEQP-QPRQDLAGKSVGSADDGVSGTVGQIMDYL-----EDDAGA 64

  Fly   137 GDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKRKYEKRKQ-QN 200
            ..::|::.|:....|.| ..|.||.|.|:.:......:....|..||::  ..|..:.|.|. ::
  Fly    65 TADQDAEMGEAEYLDGE-MPQEDESETPQTEKANEGCQESSNKKDLQES--AAKDDFSKEKSGED 126

  Fly   201 KAKITE-----LSLRESRARQRELKRSSAGAED--------DQDGDED-----EEDEEDVGGELT 247
            ..|.|:     ..|.|......|.....|.|||        |:||.|:     ||||:.:..:..
  Fly   127 GEKDTDKEKKATHLHEDNNDDAEKDGDEADAEDEDDVEKPEDEDGTEEGDEAIEEDEDALDEDED 191

  Fly   248 PDAD-EQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAIC------ 305
            |:.: |:.:|..:.|.....:|:|.|:..|.::||::....:|..|      :..|.:|      
  Fly   192 PNEEVEEIEPDFETGTDAEGELITGDEPGDLADVPIRERKKEEPVD------EDQCRVCTSKEEL 250

  Fly   306 ---------AAPLE-------DFNDLKRHFRVEHDCTGYVKCCNN-----RYKKRTLYVDHLHCH 349
                     |.|.:       :.:.|.:.|..:..||   ||..:     :.:|:....|     
  Fly   251 VCLFKKQIDATPADMLLVICPNVSILPKDFMPQFICT---KCMGSLTIAIQLRKQLETTD----- 307

  Fly   350 KDPQYFSCQSCRKNFLNRNSQVMHMLRFH-----------SQQQELVHQCAICE----------- 392
                    |..||. |:|:...:...|.:           ..:.||..:..:.:           
  Fly   308 --------QELRKR-LSRSKNKVRRPRGYVVIDAPVTDSSEDEDELDDEFKVSDVAGTTSADSDS 363

  Fly   393 ----------------ARFAKKFLLTMHLKGHKGTE---RPEVCDTCSKTFRTKFELSAHVKRMH 438
                            .|..||.|       .:||:   .|      |...:.|::.|:      
  Fly   364 ADSDDSEKEKKKPGPRGRPRKKPL-------KRGTDSDGEP------SSAQKKKYQPSS------ 409

  Fly   439 AADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDG 503
            .|...|..|..|...|..|.::::|:|. |..   .|..|.:||:..:.|.:.:.|:.||:..  
  Fly   410 TASVGPFECPNCDLTFSRKQSYVLHRKT-HER---IEHACPICGKKFKVEWAYKTHMQRHEQE-- 468

  Fly   504 DTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFC 568
            ...:||.||......||.|.     ||.|:||.               ||     |. :|:|:.|
  Fly   469 RAHFRCELCPKIFRLRAELK-----HHMAQRHD---------------EH-----GF-IYECKRC 507

  Fly   569 TRTFKSHANMHNHKK---KMHPNDWVR------KYSQPSSSITSTAAPLAHPNHPNQPAP----- 619
            .|||.:...:..|:.   :.|..|.||      ::.|.|.|....    .|.|:.::..|     
  Fly   508 QRTFLTQQRLQRHQAVGCQRHKEDSVRIKEEQSRFKQESRSKDDR----HHGNNSSKRRPGEGRD 568

  Fly   620 --PAAAP 624
              .|.||
  Fly   569 LFKAVAP 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 2/22 (9%)
C2H2 Zn finger 357..378 CDD:275368 6/21 (29%)
C2H2 Zn finger 388..408 CDD:275368 4/47 (9%)
C2H2 Zn finger 417..438 CDD:275368 3/21 (14%)
C2H2 Zn finger 447..465 CDD:275368 5/18 (28%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
C2H2 Zn finger 509..529 CDD:275368 6/20 (30%)
C2H2 Zn finger 537..557 CDD:275368 2/20 (10%)
C2H2 Zn finger 565..583 CDD:275368 6/18 (33%)
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 15/89 (17%)
zf-C2H2 416..438 CDD:278523 6/23 (26%)
C2H2 Zn finger 418..438 CDD:275368 6/21 (29%)
zf-C2H2 443..465 CDD:278523 6/22 (27%)
C2H2 Zn finger 445..465 CDD:275368 6/20 (30%)
C2H2 Zn finger 474..491 CDD:275368 8/22 (36%)
C2H2 Zn finger 504..521 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.