DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11696 and CG11695

Sequence 1:NP_572731.1 Gene:CG11696 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster

Alignment Length:595 Identity:242/596 (41%)
Similarity:313/596 (53%) Gaps:107/596 (18%)


  Fly     1 MICRLCLEDAEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAEIE 65
            |||||||:||||.||||.|:....||....||||||:||.|||..||.||..||.:||:|||:.|
  Fly     1 MICRLCLDDAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLADFE 65

  Fly    66 QFCSMVAEKQRSLHRSLQLKTELPELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHILCEPV 130
            |||:||.:||..|.   |||                        :||....|..|.|..|||||.
  Fly    66 QFCAMVMKKQLGLQ---QLK------------------------MEPFSEDEDADTKAQILCEPE 103

  Fly   131 IDALSAGDEKDSDYGDTFEPDFEPESQPDE------EEEPEPDPVKPRPRGRPRKTALQQTHQII 189
            ||...|.  .|::..:..:.|....|:...      .|...|.|::.|.| .||.....:| |.:
  Fly   104 IDVSPAA--ADNEECNEIDGDASSNSRSSSIRTTSLREMRLPSPIRRRMR-LPRAVTAPKT-QAV 164

  Fly   190 KRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQP 254
            |.|  .|.:.:||                            :.||||:.|    ||..|::    
  Fly   165 KAK--ARTKTHKA----------------------------EADEDEDAE----GEGDPES---- 191

  Fly   255 KPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAA--PLEDFNDLKR 317
                                        :.|:.:|||.|||.:.:|:|.||..  ...:|.::||
  Fly   192 ----------------------------RSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKR 228

  Fly   318 HFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQ 382
            |||..|...|||.||..|||||.|||||||.|.||.||.|:.|.|..::|.|..:||||||..:.
  Fly   229 HFRNHHQSLGYVVCCQRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKD 293

  Fly   383 ELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPIIC 447
            :|...|..|..||:|:||||:|.:.|: .||.|.|..|.::|||..:|..|::|.|...|.|.||
  Fly   294 DLSFACDQCSKRFSKQFLLTIHSRVHQ-QERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFIC 357

  Fly   448 DICGTHFRSKANFLIHKKALHPDG-PVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLL 511
            |.||..|::|.|.|:||:.:|.:| .:.||||..|..||.||.|||||:..|.|.....:::|..
  Fly   358 DSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQ 422

  Fly   512 CNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHA 576
            |..||.|||.|::|:||||..:.|||:.|.||||..|:|.||.|||||.|||:|.||.||||:..
  Fly   423 CGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSG 487

  Fly   577 NMHNHKKKMH 586
            |||.|:::||
  Fly   488 NMHKHRRQMH 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 47/76 (62%)
C2H2 Zn finger 332..349 CDD:275368 13/17 (76%)
C2H2 Zn finger 357..378 CDD:275368 10/21 (48%)
C2H2 Zn finger 388..408 CDD:275368 10/20 (50%)
C2H2 Zn finger 417..438 CDD:275368 8/21 (38%)
C2H2 Zn finger 447..465 CDD:275368 10/18 (56%)
C2H2 Zn finger 478..498 CDD:275368 11/20 (55%)
C2H2 Zn finger 509..529 CDD:275368 11/20 (55%)
C2H2 Zn finger 537..557 CDD:275368 12/20 (60%)
C2H2 Zn finger 565..583 CDD:275368 11/18 (61%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 49/82 (60%)
C2H2 Zn finger 268..289 CDD:275368 10/21 (48%)
C2H2 Zn finger 299..319 CDD:275368 10/20 (50%)
C2H2 Zn finger 327..348 CDD:275368 8/21 (38%)
C2H2 Zn finger 357..376 CDD:275368 10/19 (53%)
C2H2 Zn finger 389..409 CDD:275368 11/20 (55%)
C2H2 Zn finger 420..440 CDD:275368 11/20 (55%)
C2H2 Zn finger 448..468 CDD:275368 12/20 (60%)
C2H2 Zn finger 476..494 CDD:275368 11/18 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3C0KF
Homologene 1 1.000 H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.