DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCO1

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_200374.1 Gene:KCO1 / 835657 AraportID:AT5G55630 Length:363 Species:Arabidopsis thaliana


Alignment Length:86 Identity:29/86 - (33%)
Similarity:40/86 - (46%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 FLGVYLAAGAGLLLLWEDDWT------FFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIG 306
            ||.:||..|.....|..|..:      ..|..|||.:||||:|:|||||......||...::..|
plant    82 FLALYLTIGTLCFYLVRDQISGHKTSGVVDALYFCIVTMTTVGYGDLVPNSSASRLLACAFVFSG 146

  Fly   307 LALTSTIIE-----LVRRQYA 322
            :.|...::.     ||.:|.|
plant   147 MVLVGHLLSRAADYLVEKQEA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301
Ion_trans_2 <267..319 CDD:462301 20/62 (32%)
KCO1NP_200374.1 Ion_trans_2 81..163 CDD:462301 26/80 (33%)
Ion_trans_2 202..277 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.