DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCO3

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_199448.1 Gene:KCO3 / 834679 AraportID:AT5G46360 Length:260 Species:Arabidopsis thaliana


Alignment Length:49 Identity:16/49 - (32%)
Similarity:23/49 - (46%) Gaps:10/49 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 WFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGD 287
            :|:.:...|||.|:.....|.|          |.|.|..:.:||:||||
plant   105 YFFVVTFCGFLIVHFVVKIGWL----------DSFCFSVMMVTTVGFGD 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301
Ion_trans_2 <267..319 CDD:462301 9/21 (43%)
KCO3NP_199448.1 Ion_trans_2 106..176 CDD:462301 16/48 (33%)
FRQ1 <199..>260 CDD:444056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.