DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnk13

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_071629.2 Gene:Kcnk13 / 64120 RGDID:68941 Length:405 Species:Rattus norvegicus


Alignment Length:311 Identity:90/311 - (28%)
Similarity:137/311 - (44%) Gaps:64/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNL--DELLSFE 129
            ||::   :|...|..:|..||...|::.           ::|:...:.|.:..|||  :||..| 
  Rat    25 GLIL---LYLLGGAAVFSALELAQELQA-----------KQRWEERLANFSRGHNLSREELRGF- 74

  Fly   130 LAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCIC 194
            |..||    :|.:.|:.:    |...|  ||....|.:|..||:||||:|...|.||||:||.|.
  Rat    75 LRHYE----EATKAGIRM----DSVRP--RWDFTGAFYFVGTVVTTIGFGMTTPATTGGKVFLIF 129

  Fly   195 FALIGIPFT-----------LTVIA--------DWGRLFATAVSVFGKHMPTKPKFTNFIGKTW- 239
            :.|||...|           :||||        ...|...|.....|| .|.|.:..:..|  | 
  Rat   130 YGLIGCASTILFFNLFLERLITVIAYVMRTCHHQQLRRRGTVARDNGK-APRKGEADSLAG--WK 191

  Fly   240 ---FYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPN------- 294
               :|.:|.:....|.::.||..|....:.|::||..||||:..:||||||||..:..       
  Rat   192 PSVYYVMLILCLASVAISCGASALYTTMEGWSYFDSVYFCFVAFSTIGFGDLVSSQNAQYENEGL 256

  Fly   295 YMLLCTLYILIGLALTST---IIELVRRQYATSWAKLQELSGPMAETLRRL 342
            |..:...:||:|:....:   :|.::.:| ..:|...:..||...:..|.|
  Rat   257 YRFVNFFFILMGVCCIYSMFNVISILIKQ-TVNWILRKLDSGCFPQCQRGL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 28/75 (37%)
Ion_trans <240..314 CDD:278921 25/83 (30%)
Ion_trans_2 <266..319 CDD:285168 20/62 (32%)
Kcnk13NP_071629.2 Ion_trans_2 88..150 CDD:400301 25/67 (37%)
Ion_trans_2 203..285 CDD:400301 24/81 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.