DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk3b

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_700001.2 Gene:kcnk3b / 571330 ZFINID:ZDB-GENE-120709-43 Length:383 Species:Danio rerio


Alignment Length:278 Identity:80/278 - (28%)
Similarity:120/278 - (43%) Gaps:58/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLD----ELL 126
            :.|::....|..:|..:|..||...|..:...|      ...:||  :::...:..||    |.:
Zfish     9 LALIICTLSYLLIGAGVFDALESKQEKSQKGRL------DYRKFL--LMHKYNLTRLDFDQIEKV 65

  Fly   127 SFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVF 191
            ...|..::|.||                     |....:.:|:.||:||||||:..|.|..|:.|
Zfish    66 VLLLKPHKAGVQ---------------------WKFSGSFYFAITVITTIGYGHAAPSTDAGKAF 109

  Fly   192 CICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTK------PKFTNFIGKTWFYAILAVGFLG 250
            |:.:||:|||.||.:....|....|.|. |..|...|      |:.:       ...::.:||..
Zfish   110 CMGYALLGIPLTLVMFQSLGERINTFVR-FLLHKAKKCMGLRRPEVS-------MANMVIIGFFS 166

  Fly   251 VY--LAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV--------PKKPNYMLLCTLYILI 305
            ..  |..||.....:| .||||..||:||||:|||||||.|        ...|:|:....:|||:
Zfish   167 CVSTLCIGAAAFSHYE-GWTFFHAFYYCFITLTTIGFGDYVALQKDNALQNDPHYVAFSFVYILM 230

  Fly   306 GLALTSTIIELVRRQYAT 323
            ||.:....:.||..::.|
Zfish   231 GLTVIGAFLNLVVLRFMT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 23/56 (41%)
Ion_trans <240..314 CDD:278921 31/83 (37%)
Ion_trans_2 <266..319 CDD:285168 27/60 (45%)
kcnk3bXP_700001.2 Ion_trans_2 <77..132 CDD:285168 24/75 (32%)
Ion_trans_2 167..247 CDD:285168 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.