DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnc3b

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_021325878.1 Gene:kcnc3b / 564371 ZFINID:ZDB-GENE-100901-2 Length:658 Species:Danio rerio


Alignment Length:364 Identity:74/364 - (20%)
Similarity:120/364 - (32%) Gaps:158/364 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELLSFELAK 132
            :|:|:|.:|                         ::|| |.| :||.|.||  |:.|   ..:.:
Zfish   216 ILISISTFC-------------------------METH-EAF-NTIYNKTE--NVTE---GNVTR 248

  Fly   133 YEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFC----- 192
            .|...:...:..|..|..            :..|:|:..|.|.:             |||     
Zfish   249 EEIVYEVVTDSWLTYVEG------------VCVVWFTIEVFTRV-------------VFCPDKME 288

  Fly   193 --------ICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKTWFYAILAV--- 246
                    |.|..: :||.|.|... |.....|..|.|           |:....|..||.:   
Zfish   289 FFKSPLNIIDFVAV-LPFYLEVGLS-GLSSKAAKDVLG-----------FLRVVRFVRILRIFKL 340

  Fly   247 --GFLG-------------------VYLAAG----AGLLLLWE------DDWT------FFD--- 271
              .|:|                   ::||.|    |.::...|      ||.|      |.:   
Zfish   341 TRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPDDPTASAHTNFKNIPI 405

  Fly   272 GFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQYATSWAKLQELSGPMA 336
            ||::..:||||:|:||:.|:..:.||:..|..|.|:...:..:.::...:               
Zfish   406 GFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNF--------------- 455

  Fly   337 ETLRRLGETAGTGLDYTALQKVLTVSMPKWNSKKNEHSP 375
                        |:.|:     |.::..|...|||:|.|
Zfish   456 ------------GMYYS-----LAMAKQKLPKKKNKHIP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 14/69 (20%)
Ion_trans <240..314 CDD:278921 29/116 (25%)
Ion_trans_2 <266..319 CDD:285168 18/61 (30%)
kcnc3bXP_021325878.1 Potassium_chann 1..29 CDD:314363
BTB_2 38..132 CDD:308049
Ion_trans 205..463 CDD:306908 68/348 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.