DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Shal

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001097646.1 Gene:Shal / 40129 FlyBaseID:FBgn0005564 Length:571 Species:Drosophila melanogaster


Alignment Length:396 Identity:67/396 - (16%)
Similarity:130/396 - (32%) Gaps:122/396 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KDIVKTHRERFLHTILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSIL 163
            :|..:.:.||.:...|:.....||.:|.:.....:.|                 |..|:...|.|
  Fly   138 RDRKRENAERLMDDKLSENGDQNLQQLTNMRQKMWRA-----------------FENPHTSTSAL 185

  Fly   164 QAVFFSSTVLTTIGYGNIVPVTTGGR-----------------VFCICFALIGIPFTLTVIADWG 211
            ...:.:...:......|:|.....|.                 .||:..|.:.| ||...:.   
  Fly   186 VFYYVTGFFIAVSVMANVVETVPCGHRPGRAGTLPCGERYKIVFFCLDTACVMI-FTAEYLL--- 246

  Fly   212 RLFA---------TAVSV--------------------------------------FGKHMPTKP 229
            ||||         :.:|:                                      |.:|    .
  Fly   247 RLFAAPDRCKFVRSVMSIIDVVAIMPYYIGLGITDNDDVSGAFVTLRVFRVFRIFKFSRH----S 307

  Fly   230 KFTNFIGKTWFYAILAVGFLGVYLAAG----AGLLLLWED--DWTFFD----GFYFCFITMTTIG 284
            :....:|.|.......:|||...||..    |.::...|.  :.|.|.    .|::..:||||:|
  Fly   308 QGLRILGYTLKSCASELGFLVFSLAMAIIIFATVMFYAEKNVNGTNFTSIPAAFWYTIVTMTTLG 372

  Fly   285 FGDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQYATSWAKLQELSGPMAETLRRLGE----T 345
            :||:||:.....::..:..|.|:.:.:..:.::...::..:.:.|......|:...||..    .
  Fly   373 YGDMVPETIAGKIVGGVCSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRKAQRKARLARIRIAK 437

  Fly   346 AGTGLDYTALQKVLTVSMPKWNSKKN----------------EHSPDIAALEAITNAILKEVKEA 394
            |.:|..:.:.:|   .:..:|.::::                :|...:..||..|:....|::..
  Fly   438 ASSGAAFVSKKK---AAEARWAAQESGIELDDNYRDEDIFELQHHHLLRCLEKTTDREFVELEIP 499

  Fly   395 QNNKPK 400
            .|.:||
  Fly   500 FNGQPK 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 12/73 (16%)
Ion_trans <240..314 CDD:278921 21/83 (25%)
Ion_trans_2 <266..319 CDD:285168 14/56 (25%)
ShalNP_001097646.1 BTB_POZ_Shal-like 6..144 CDD:349727 1/5 (20%)
Ion_trans 188..415 CDD:395416 39/234 (17%)
DUF3399 445..540 CDD:403174 10/64 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
11.000

Return to query results.
Submit another query.