DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCNA2

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_004965.1 Gene:KCNA2 / 3737 HGNCID:6220 Length:499 Species:Homo sapiens


Alignment Length:181 Identity:36/181 - (19%)
Similarity:73/181 - (40%) Gaps:38/181 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KFTNFIGKTWFYAILAVG------FLGVYLAAGAGLLLLWEDDWTFF----DGFYFCFITMTTIG 284
            |....:|:|...::..:|      |:||.|.:.|......::..:.|    |.|::..::|||:|
Human   312 KGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVG 376

  Fly   285 FGDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQYATSWAKLQELSGPMAETLRRLGETAGTG 349
            :||:||......::.:|..:.|:...:..:.::...:...:.:..|            ||.....
Human   377 YGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE------------GEEQAQY 429

  Fly   350 LDYTALQKVLTVSMPKWNSKKNEHSPDI---AALEAITNAILKEVKEAQNN 397
            |..|:..|:             ..|||:   .:...|:.:...|::|..||
Human   430 LQVTSCPKI-------------PSSPDLKKSRSASTISKSDYMEIQEGVNN 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168
Ion_trans <240..314 CDD:278921 19/83 (23%)
Ion_trans_2 <266..319 CDD:285168 13/56 (23%)
KCNA2NP_004965.1 Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P63142 1..125
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
BTB_POZ 33..159 CDD:365784
Ion_trans 162..420 CDD:395416 22/107 (21%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 312..325 3/12 (25%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 374..379 2/4 (50%)
PDZ-binding. /evidence=ECO:0000250|UniProtKB:P63142 497..499
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.