DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-29

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001021467.1 Gene:twk-29 / 185828 WormBaseID:WBGene00006681 Length:476 Species:Caenorhabditis elegans


Alignment Length:272 Identity:72/272 - (26%)
Similarity:127/272 - (46%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNT 117
            |.|..:...|:|.. ::|.|.||..:||.||.:.    |.|...::|......:...:.::||. 
 Worm    41 CLQHNRRAIAVNGF-IIVFLIIYTTIGGFIFLNF----EFEYQQYMKQNATLEKRLCIESLLNR- 99

  Fly   118 EVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYE----RWSILQAVFFSSTVLTTIGY 178
                 |..|....|...||.          :|::...|..:    :||...|..:|..:|||:||
 Worm   100 -----DNRLRLTRASDVAAA----------IAERCLTENVKDDRMQWSFKSAALYSLGILTTLGY 149

  Fly   179 GNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTK----PKFTNFIGKTW 239
            |.|.|.|..||:..:.:...|||.|:.::.::||......:.|.:.:..:    .:..|..|.|.
 Worm   150 GKIEPQTINGRISTVIYGFFGIPLTVILLTNFGRYLEAMATRFRRLISCRRRREDEDENVSGSTL 214

  Fly   240 FYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYIL 304
            |:.:|      |||..||.::.|....:.||:|.|:.||.:|.|.:||::|:...::.:...|:.
 Worm   215 FFIVL------VYLILGATMIPLMSGQFDFFNGIYYAFICLTAIEYGDIIPQNNWFLPISVFYMC 273

  Fly   305 IGLALTSTIIEL 316
            .|||:::..:::
 Worm   274 TGLAISTIALDI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 21/60 (35%)
Ion_trans <240..314 CDD:278921 23/73 (32%)
Ion_trans_2 <266..319 CDD:285168 15/51 (29%)
twk-29NP_001021467.1 Ion_trans_2 127..186 CDD:285168 21/58 (36%)
Ion_trans_2 216..292 CDD:285168 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.