DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and AgaP_AGAP004720

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_318109.3 Gene:AgaP_AGAP004720 / 1278508 VectorBaseID:AGAP004720 Length:205 Species:Anopheles gambiae


Alignment Length:150 Identity:35/150 - (23%)
Similarity:60/150 - (40%) Gaps:33/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKT----------HR- 106
            |.|:.|.:.| :.:|:.|.:..|..:|.::|..||...|.      .||::|          |. 
Mosquito    46 CQQAPKSQCA-SALGVFVLVLAYTALGSVLFVTLEGDGED------GDIIETSVAASKPYPRHEL 103

  Fly   107 ---ERFLHTI---------LNNTEVHNLDELLSFELAKYEAAVQQAAEGGLL--IVADKDFPEPY 157
               |..|.|:         ||.....|...|.:.|:..::..:.:|......  :...:....||
Mosquito   104 VSAEMRLKTVDRLWSITEDLNILYKENWTRLAAQEVLHFQDTIIRAVRASRTQQVTNVQQNTRPY 168

  Fly   158 ERWSILQAVFFSSTVLTTIG 177
             :|:...|..:|.|::||||
Mosquito   169 -KWTFASAFLYSLTLITTIG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 8/20 (40%)
Ion_trans <240..314 CDD:278921
Ion_trans_2 <266..319 CDD:285168
AgaP_AGAP004720XP_318109.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.