DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and AgaP_AGAP008202

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_317265.4 Gene:AgaP_AGAP008202 / 1277769 VectorBaseID:AGAP008202 Length:558 Species:Anopheles gambiae


Alignment Length:114 Identity:25/114 - (21%)
Similarity:48/114 - (42%) Gaps:28/114 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 GFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQYATSWAKLQELSGPMA 336
            |.::..:||||:|:||:.||....|.:..|..|.|:...:..:.::...::..::..|..| .:.
Mosquito   455 GLWWAIVTMTTVGYGDMAPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSMFYSHTQARS-KLP 518

  Fly   337 ETLRRLGETAGTGLDYTALQKVLTVSMP-----------KWNSKKNEHS 374
            :..||                ||.|..|           :.|:.|::|:
Mosquito   519 KKRRR----------------VLPVEQPRRKRDMGVANRRVNALKHQHT 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168
Ion_trans <240..314 CDD:278921 14/41 (34%)
Ion_trans_2 <266..319 CDD:285168 14/46 (30%)
AgaP_AGAP008202XP_317265.4 BTB_2 38..117 CDD:280393
BTB 40..119 CDD:197585
Ion_trans 321..512 CDD:278921 14/56 (25%)
Ion_trans_2 <455..505 CDD:285168 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.