DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and AgaP_AGAP000254

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_003436950.1 Gene:AgaP_AGAP000254 / 1272004 VectorBaseID:AGAP000254 Length:612 Species:Anopheles gambiae


Alignment Length:151 Identity:34/151 - (22%)
Similarity:64/151 - (42%) Gaps:29/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KFTNFIGKTWFYAILAVG------FLGVYLAAGAGLLLLWEDDWTFF----DGFYFCFITMTTIG 284
            |....:|:|...::..:|      |:||.|.:.|........:.:||    |.|::..:||||:|
Mosquito   336 KGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGTEMSFFKSIPDAFWWAVVTMTTVG 400

  Fly   285 FGDLVPKKPNYML---LCTLYILIGLALTSTII--------------ELVRRQYATSWAKLQELS 332
            :||:.|......:   ||.:..::.:||...:|              |.::.|..........|.
Mosquito   401 YGDMRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQSQNFNHVTSCPYLP 465

  Fly   333 GPMAETLRR--LGETAGTGLD 351
            |.:.:.|::  |.|::...:|
Mosquito   466 GTLGQHLKKTSLSESSSDMMD 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168
Ion_trans <240..314 CDD:278921 22/86 (26%)
Ion_trans_2 <266..319 CDD:285168 18/73 (25%)
AgaP_AGAP000254XP_003436950.1 BTB_2 54..142 CDD:280393
BTB 54..138 CDD:197585
Ion_trans 230..444 CDD:278921 26/107 (24%)
Ion_trans_2 359..435 CDD:285168 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.