DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnv2

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_002934230.1 Gene:kcnv2 / 100498412 XenbaseID:XB-GENE-940169 Length:562 Species:Xenopus tropicalis


Alignment Length:178 Identity:40/178 - (22%)
Similarity:72/178 - (40%) Gaps:43/178 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KSALNHIGLLVSLSIY-------------CGVGGLIFRHLERPAEVERLSHLKDIVKTHR-ERFL 110
            :|.||.:.|:..|.:|             .|.|......:|....|.:|..:..|::..| .|.|
 Frog   340 RSVLNAVDLIAILPLYLQMLLESFADEDRSGKGSSHEHEIEAVGRVGKLGQVLRIMRLMRIFRIL 404

  Fly   111 HTILNNT--------------EVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWS 161
            ....::|              :|..|...::..:..:.|.|......    |:..:|.      |
 Frog   405 KLARHSTGLRAFGFTLRQCYQQVGCLFLFIAMGVFSFSAMVYSVEHD----VSGTNFT------S 459

  Fly   162 ILQAVFFSSTVLTTIGYGNIVPVTTGGRVF---CICFALI--GIPFTL 204
            |..|.::::..::|:|||::.|.|..||:|   ||.|.:|  |:|.::
 Frog   460 IPHAWWWAAVSISTVGYGDVYPETHLGRLFAFLCIAFGIILNGMPISI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 18/53 (34%)
Ion_trans <240..314 CDD:278921
Ion_trans_2 <266..319 CDD:285168
kcnv2XP_002934230.1 BTB 112..212 CDD:197585
BTB 112..201 CDD:295341
Ion_trans 310..520 CDD:278921 40/178 (22%)
Ion_trans_2 445..508 CDD:285168 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.