DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcns3

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_031758930.1 Gene:kcns3 / 100497261 XenbaseID:XB-GENE-952059 Length:490 Species:Xenopus tropicalis


Alignment Length:176 Identity:40/176 - (22%)
Similarity:74/176 - (42%) Gaps:40/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QSMKWKSALNHIGLLVSLSIYC------------GVGGLIFRHLERPAEVERLSHLKDIVKTHRE 107
            |...||:.:|.|..:..:..|.            |:     .::.:..::.||..:..|:|..|.
 Frog   251 QKKFWKNPMNIIDFVSIIPFYATLVVDVNDEENEGI-----ENMGKVVQILRLMRIFRILKLARH 310

  Fly   108 ----RFLHTILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAV-- 166
                |.|...|.:: .|.:..||.|      .||..:....|:...:||     |..|.|.::  
 Frog   311 SVGLRSLGATLKHS-YHEVGLLLLF------LAVGISIFSVLVYYVEKD-----EDQSGLHSIPM 363

  Fly   167 --FFSSTVLTTIGYGNIVPVTTGGRV---FCICFALIGIPFTLTVI 207
              ::::..:||:|||:..|||..|::   .||...::.:...:|:|
 Frog   364 CWWWATISMTTVGYGDTHPVTLFGKLVGTVCIICGILVVALPITII 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 16/58 (28%)
Ion_trans <240..314 CDD:278921
Ion_trans_2 <266..319 CDD:285168
kcns3XP_031758930.1 BTB_POZ_KCNS3 15..122 CDD:349735
Ion_trans 185..421 CDD:395416 40/176 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.