DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcng4

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_002934997.1 Gene:kcng4 / 100497160 XenbaseID:XB-GENE-985941 Length:506 Species:Xenopus tropicalis


Alignment Length:194 Identity:40/194 - (20%)
Similarity:74/194 - (38%) Gaps:62/194 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TAC--WQSMK--------------WKSALNHIGLLVSLSIYCGVGGLIF----RHLERPAEVERL 95
            |.|  |.|::              :|..||.|.:|..|..|.   .||.    :.:::|:....|
 Frog   265 TICVAWFSLEFFLRFIQAKSKCQFFKGPLNIIDVLAILPYYV---SLIVEDEQKTVDKPSSNSYL 326

  Fly    96 SHLKDIVKTHRE-RFLHTILNNTEVHNLDELLSFELAKYEAAVQQ--------AAEGGLLI---- 147
            ..:..:::..|. |.|:.:               .||::...:|.        ..|.|||:    
 Frog   327 EKIGLVLRVLRALRILYVM---------------RLARHSLGLQTLGLTVRRCTREFGLLLLFLC 376

  Fly   148 -----------VADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGI 200
                       :|:.:.....|..|:..:.:::...:||:|||::||.:..|:|..:...|.||
 Frog   377 VAVTLFAPLVHLAENEMGRCQEFTSVPASYWWAIISMTTVGYGDMVPRSIPGQVVALSSILSGI 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 14/44 (32%)
Ion_trans <240..314 CDD:278921
Ion_trans_2 <266..319 CDD:285168
kcng4XP_002934997.1 BTB_POZ_KCNG4 59..170 CDD:349730
Ion_trans 219..462 CDD:366146 40/194 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.