DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcng1

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001096675.1 Gene:kcng1 / 100125206 XenbaseID:XB-GENE-1011042 Length:508 Species:Xenopus tropicalis


Alignment Length:90 Identity:26/90 - (28%)
Similarity:47/90 - (52%) Gaps:7/90 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 FLGVYLAAGAGLLLLWEDDWTFFDGF-------YFCFITMTTIGFGDLVPKKPNYMLLCTLYILI 305
            ||.|.:|..|.||.|.|::......|       ::..|||||:|:||:||:.....::....||.
 Frog   377 FLCVAIALFAPLLYLIENEMADSQEFTSIPACYWWAVITMTTVGYGDMVPRSIPGQVVALSSILS 441

  Fly   306 GLALTSTIIELVRRQYATSWAKLQE 330
            |:.|.:..:..:...::.|:.:|::
 Frog   442 GILLMAFPVTSIFHTFSRSYIELKQ 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168
Ion_trans <240..314 CDD:278921 24/72 (33%)
Ion_trans_2 <266..319 CDD:285168 15/59 (25%)
kcng1NP_001096675.1 BTB_POZ_KCNG1_2 59..172 CDD:349728
Ion_trans 221..461 CDD:366146 24/83 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.