DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sk1 and Agk

Sequence 1:NP_572717.1 Gene:Sk1 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_076027.1 Gene:Agk MGIID:1917173 Length:421 Species:Mus musculus

Alignment Length:475 Identity:101/476 (21%)
Similarity:177/476 (37%) Gaps:146/476 (31%)


  Fly   178 GNGSSSPADCGKQLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRTRR 242
            ||....|....|:..:.|||.:..||.|.||:|..||:|..:.:...:..|.:...||:.:    
Mouse    50 GNQLIPPNAQVKKATVFLNPAACKGKARTLFEKNAAPILHLSGMDVTVVKTDYEGQAKKLL---- 110

  Fly   243 DLLTRYSGIVVASGDGLFYEVLNGLMERMDWRRACRELPLGIIPCGSGNGLAKSV-AHHCNEPYE 306
            :|:.....|:||.|||...||:.|::.|.| .....::|:|.||.|..:.|:.:: |...|   :
Mouse   111 ELMESTDVIIVAGGDGTLQEVVTGVLRRTD-EATFSKIPIGFIPLGQTSSLSHTLFAESGN---K 171

  Fly   307 PKPILHATLTCMAGKSTPMDVVRVELATRDKHFVMYSFLSVGWGLIADIDIESER------LRSI 365
            .:.|..|||..:.|::.|:||::::   .:|...:|:...:.||...|..::..:      |::.
Mouse   172 VQHITDATLAIVKGETVPLDVLQIK---GEKEQPVYAMTGLRWGSFRDAGVKVSKYWYLGPLKTK 233

  Fly   366 GAQRFTL---WAIKRLIGLRSYKGRVSYLLGKGKKE-PPVEAARELPAESTAAGIRSSLPLNAGE 426
            .|..|:.   |.       ::::..:||   .|.:| ||:|                        
Mouse   234 AAHFFSTLQEWP-------QTHQASISY---TGPRERPPIE------------------------ 264

  Fly   427 FHDLPEEEEGEAVLDGEQFADAISLDRSVYRQHADSW---HSAMSRRTAYYSLGGPSMRSNRSRM 488
                |||.....           ||.|.:.|:.|..|   ..|.||..:      |.:..:....
Mouse   265 ----PEETPPRP-----------SLYRRILRRLASFWAQPQDASSREVS------PEVWKDVQLS 308

  Fly   489 SISQRIEAANAEFAERVPTGTIPPLQMPLLSSDGW--IC------EDGDFVMVHAAYTTHLSSDV 545
            :|...|...|.              |:.|:|.:.:  ||      ..|||:::            
Mouse   309 TIELSITTRNT--------------QLDLMSKEDFMNICIEPDTVSKGDFIII------------ 347

  Fly   546 FFAPESRLDDGLIYLVIIRRGVSRHQLLNFMLNLNAGTHLPIGEDPFIKVVPCRAFRIEPSSSDG 610
              ..:...|.||                     ..|||..       ::...|..  :.|..::|
Mouse   348 --GSKKVRDPGL---------------------RAAGTEC-------LQASHCTL--VLPEGTEG 380

  Fly   611 ILVVDGERVEYGPIQAEVMP 630
            ...:|.|..|..|::.:::|
Mouse   381 SFSIDSEEYEAMPVEVKLLP 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 96/455 (21%)
DAGK_cat 191..330 CDD:279163 43/140 (31%)
AgkNP_076027.1 Hydrophobic. {ECO:0000250|UniProtKB:Q53H12} 15..31
DAGK_cat 62..195 CDD:279163 43/141 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.