DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sk1 and CERK

Sequence 1:NP_572717.1 Gene:Sk1 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_073603.2 Gene:CERK HGNCID:19256 Length:537 Species:Homo sapiens

Alignment Length:584 Identity:141/585 (24%)
Similarity:218/585 (37%) Gaps:187/585 (32%)


  Fly   100 ARGGLNSCRNP----NVPGQEADSEPDSDNSAYLYIYA---------------YLKKEKP----- 140
            ||..|...|:|    ..||.:|.|.|.|:      |.|               :.|.|||     
Human    28 ARALLRWWRSPGPGAGAPGADACSVPVSE------IIAVEETDVHGKHQGSGKWQKMEKPYAFTV 86

  Fly   141 --LRRVQTLRILRFRSSNDYGVNLQTAEMWHHTIRKHKRGNGSSSPADCGKQLLILLNPKSGSGK 203
              ::|.:..| .::.....:....|...:|..|:|:... ..:|.|    |.||:.:||..|.|:
Human    87 HCVKRARRHR-WKWAQVTFWCPEEQLCHLWLQTLREMLE-KLTSRP----KHLLVFINPFGGKGQ 145

  Fly   204 GRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRTRRDL-LTRYSGIVVASGDGLFYEVLNGL 267
            |:.:::::||||.|.|.:..|:.:|.|...|||   |..:: :.:|.|||...|||:|.|||:||
Human   146 GKRIYERKVAPLFTLASITTDIIVTEHANQAKE---TLYEINIDKYDGIVCVGGDGMFSEVLHGL 207

  Fly   268 MER--------MDWRRAC---RELPLGIIPCGS---------GNGLAKSVAHHCNEPYEPKPILH 312
            :.|        .:..||.   ..|.:||||.||         |...|::.|.|            
Human   208 IGRTQRSAGVDQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALH------------ 260

  Fly   313 ATLTCMAGKSTPMDVVRVELATRDKHFVMYSFLSVGWGLIADIDIESERLRSIGAQRFTLWAIKR 377
                .:.|.|..|||..|.   .:...:.||...:|:|...||..:||:.|.:|..|:....:|.
Human   261 ----IVVGDSLAMDVSSVH---HNSTLLRYSVSLLGYGFYGDIIKDSEKKRWLGLARYDFSGLKT 318

  Fly   378 LIGLRSYKGRVSYLLGKGKKEPPVEAARELPAESTAAGIRSSLPLNAGEF------HDLPEEEEG 436
            .:....|:|.||:                |||:.|....|...|..||.|      ..|  |||.
Human   319 FLSHHCYEGTVSF----------------LPAQHTVGSPRDRKPCRAGCFVCRQSKQQL--EEEQ 365

  Fly   437 EAVLDGEQFADAISLDRSVYRQHADSWHSAMSRRTAYYSLGGPSMRSNRSRMSISQRIEAANAEF 501
            :..|.|.:.|:.:           :.|....          |..:..|.:.||.:.|        
Human   366 KKALYGLEAAEDV-----------EEWQVVC----------GKFLAINATNMSCACR-------- 401

  Fly   502 AERVPTGTIPPLQMPLLSSDGWICEDGDFVMVHAAYTTHLSSDVFFAPESRLDDGLIYLVIIRRG 566
              |.|.|                                      .:|.:.|.||...|::||: 
Human   402 --RSPRG--------------------------------------LSPAAHLGDGSSDLILIRK- 425

  Fly   567 VSRHQLLNFML-NLNAGTHLPIGEDPFIKVVPCRAFR-----IEPSSSDGILVVDGERVEYGPI 624
            .||...|.|:: :.|.....   :..|::|...:.|:     :|...||   :.:|.:..:|.|
Human   426 CSRFNFLRFLIRHTNQQDQF---DFTFVEVYRVKKFQFTSKHMEDEDSD---LKEGGKKRFGHI 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 114/466 (24%)
DAGK_cat 191..330 CDD:279163 52/160 (33%)
CERKNP_073603.2 Required for binding to sulfatide and phosphoinositides 1..125 23/105 (22%)
PLN02204 55..528 CDD:215126 131/558 (23%)
Substrate binding. {ECO:0000250} 195..198 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108702060
eggNOG 1 0.900 E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D681139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R653
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.