DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sk1 and SPHK2

Sequence 1:NP_572717.1 Gene:Sk1 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:XP_016882497.1 Gene:SPHK2 HGNCID:18859 Length:716 Species:Homo sapiens

Alignment Length:599 Identity:200/600 (33%)
Similarity:294/600 (49%) Gaps:100/600 (17%)


  Fly    99 RARGGLNSCRNPNVPGQEAD------SEPDSDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSND 157
            |.||||       ||..|..      |...||::||..||.|.:..:..||..| |..|...:..
Human   148 RPRGGL-------VPLAEVSGCCTLRSRSPSDSAAYFCIYTYPRGRRGARRRAT-RTFRADGAAT 204

  Fly   158 YGVNLQTAEMWHHTIRKHKR-----GNGSSSPADCGK--QLLILLNPKSGSGKGRELFQKQVAPL 215
            |..|...|:.|...:....|     |:|..:|....:  :||:|:||..|.|...:..:..|.|:
Human   205 YEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRPPRLLLLVNPFGGRGLAWQWCKNHVLPM 269

  Fly   216 LTEAEVQYDLQITTHPQYAKEFVRTRRDLLTRYSGIVVASGDGLFYEVLNGLMERMDWRRACREL 280
            ::||.:.::|..|....:|:|.|:...  |:.:.|||..|||||.:||||||::|.||..|.: :
Human   270 ISEAGLSFNLIQTERQNHARELVQGLS--LSEWDGIVTVSGDGLLHEVLNGLLDRPDWEEAVK-M 331

  Fly   281 PLGIIPCGSGNGLAKSVAHHCNEPYEP----KPILHATLTCMAGKSTPMDVVRVELATRDKHFVM 341
            |:||:||||||.||.:|..|..  :||    ..:|:.:|....|...|:|::.|.||:..:.|  
Human   332 PVGILPCGSGNALAGAVNQHGG--FEPALGLDLLLNCSLLLCRGGGHPLDLLSVTLASGSRCF-- 392

  Fly   342 YSFLSVGWGLIADIDIESERLRSIGAQRFTLWAIKRLIGLRSYKGRVSYL--------------L 392
             |||||.||.::|:||:|||.|::|:.||||..:..|..|.:|:||:|||              |
Human   393 -SFLSVAWGFVSDVDIQSERFRALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHSL 456

  Fly   393 GKGKKE--------PPV----------EAARELPAESTAA-GIRSSLP---LNAGEFHDLPE--- 432
            .:.|.|        ||:          :....||..:.|: |....||   ||.|.    ||   
Human   457 PRAKSELTLTPDPAPPMAHSPLHRSVSDLPLPLPQPALASPGSPEPLPILSLNGGG----PELAG 517

  Fly   433 --EEEGEAVLDGEQFADAISLDRSVYRQHADSWHSAMSRRTAYYSLGGPSM--RSNRSRMSISQR 493
              ...|:|.|..:      .|..|.......:.||.:|.       |.|.:  .|.....:...|
Human   518 DWGGAGDAPLSPD------PLLSSPPGSPKAALHSPVSE-------GAPVIPPSSGLPLPTPDAR 569

  Fly   494 IEAANAEFAERVPTGTIPPLQMPLLSSDGWICEDGDFVMVHAAYTTHLSSDVFFAPESRLDDGLI 558
            :.|:..    ..|...:|||..||  ...|:..:||||::.|...:||.:|:..||.:|.||||:
Human   570 VGASTC----GPPDHLLPPLGTPL--PPDWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLV 628

  Fly   559 YLVIIRRGVSRHQLLNFMLNLNAGTHLPIGEDPFIKVVPCRAFRIEPSSSDGILVVDGERVEYGP 623
            :|..:|.|:||..||...|.:..|:|..:| .|.:.....||||:||.:..|:|.||||:|||||
Human   629 HLCWVRSGISRAALLRLFLAMERGSHFSLG-CPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGP 692

  Fly   624 IQAEVMPGLINVMT 637
            :||::.||:..::|
Human   693 LQAQMHPGIGTLLT 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 164/482 (34%)
DAGK_cat 191..330 CDD:279163 55/143 (38%)
SPHK2XP_016882497.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108635657
eggNOG 1 0.900 E1_COG1597
Hieranoid 1 1.000
Homologene 1 1.000 H32456
Inparanoid 1 1.050 282 1.000 Inparanoid score I2838
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D561206at33208
OrthoFinder 1 1.000 FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128162
Panther 1 1.100 O PTHR12358
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R653
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.