DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sk1 and Sphk2

Sequence 1:NP_572717.1 Gene:Sk1 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_001166032.1 Gene:Sphk2 MGIID:1861380 Length:617 Species:Mus musculus

Alignment Length:663 Identity:204/664 (31%)
Similarity:312/664 (47%) Gaps:110/664 (17%)


  Fly    31 VASGTPTELSEIFFVDNSRRKQSIKIQVKLCPEGVYLRR-ETEEDDHINEQLIRIDDIIGSRYGR 94
            ||:.||....|.    .|......:..:.|..:.::::| ..:.:....:.|:.:|::.|.    
Mouse     9 VAASTPILHGEF----GSYPANGPRFALTLTTQALHIQRLRPKPEARPRDGLVSLDEVSGC---- 65

  Fly    95 RLKKRARGGLNSCRNPNVPGQEADSEPDSDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSNDYG 159
                   |.|.| |:|            .|.:||..||.|.:..:..||..| |..|...:..|.
Mouse    66 -------GTLQS-RSP------------EDTAAYFCIYTYPRGRRGGRRRAT-RTFRADGATTYE 109

  Fly   160 VNLQTAEMWHHTIRKHKRGNGSSSPADCGKQ-------LLILLNPKSGSGKGRELFQKQVAPLLT 217
            .|...|:.|...:....||...|...:...:       ||||:||..|.|...:.....|.|:::
Mouse   110 ENRAEAQRWATALTCLLRGVPLSGDQEITPELLPRKPRLLILVNPFGGRGLAWQRCMDHVVPMIS 174

  Fly   218 EAEVQYDLQITTHPQYAKEFVRTRRDLLTRYSGIVVASGDGLFYEVLNGLMERMDWRRACRELPL 282
            ||.:.::|..|....:|:|.|:...  |:.:.|||..|||||.|||||||::|.||..|.| :|:
Mouse   175 EAGLSFNLIQTERQNHARELVQGLS--LSEWEGIVTVSGDGLLYEVLNGLLDRPDWEDAVR-MPI 236

  Fly   283 GIIPCGSGNGLAKSVAHH--CNEPYEPKPILHATLTCMAGKSTPMDVVRVELATRDKHFVMYSFL 345
            |::||||||.||.:|.||  ..:......:|:.:|....|.|.|:|::.|.||:..:.|   |||
Mouse   237 GVLPCGSGNALAGAVNHHGGFEQVVGVDLLLNCSLLLCRGGSHPLDLLSVTLASGSRCF---SFL 298

  Fly   346 SVGWGLIADIDIESERLRSIGAQRFTLWAIKRLIGLRSYKGRVSYL--------------LGKGK 396
            ||.||.::|:||.|||.|::|:.||||.|:..|..|.:|:||:|||              |.:.|
Mouse   299 SVAWGFLSDVDIHSERFRALGSARFTLGAVLGLASLHTYRGRLSYLPATTEPALPIPGHSLPRAK 363

  Fly   397 KE-----PPVEAARELPAESTAAGIRSSLP----LNAGEFHDLPEEE--------------EGEA 438
            .|     .|..||...|...:.:.:...||    ::.|....||:..              .|:|
Mouse   364 SELVLAPAPAPAATHSPLHRSVSDLPLPLPQPALVSPGSPEPLPDLSLNGGGPELTGDWGGAGDA 428

  Fly   439 VLDGEQFADAISLDRSVYRQHADSWHSAMSRRTAYYS---LGGPSMRSNRSRMSISQRI-EAANA 499
            .|..:....:                |..:.:||..|   .|.|.|.::...:..:... ||:..
Mouse   429 PLSPDPLLPS----------------SPNALKTAQLSPIAEGPPEMPASSGFLPPTHSAPEASTW 477

  Fly   500 EFAERVPTGTIPPLQMPLLSSDGWICEDGDFVMVHAAYTTHLSSDVFFAPESRLDDGLIYLVIIR 564
            ...:.:    :|||..||  ...|:..:|:||::.....:||.:|:..||.:|.|||:::|..:|
Mouse   478 GPVDHL----LPPLGSPL--PQDWVTIEGEFVLMLGILPSHLCADLMAAPHARFDDGVVHLCWVR 536

  Fly   565 RGVSRHQLLNFMLNLNAGTHLPIGEDPFIKVVPCRAFRIEPSSSDGILVVDGERVEYGPIQAEVM 629
            .|:||..||..:|.:..|.|..:| .|.:.....||||:||.:..|:|.||||.||||||||:|.
Mouse   537 SGISRAALLRILLAMEHGNHFSLG-CPHLGYAAARAFRLEPLTPRGLLTVDGELVEYGPIQAQVH 600

  Fly   630 PGLINVMT-TSGQ 641
            |||..::| .:||
Mouse   601 PGLATLLTGPAGQ 613

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 158/483 (33%)
DAGK_cat 191..330 CDD:279163 57/141 (40%)
Sphk2NP_001166032.1 Required for binding to sulfatide and phosphoinositides and for membrane localization. {ECO:0000250} 1..140 34/160 (21%)
NLS. {ECO:0000269|PubMed:12954646} 87..95 2/8 (25%)
PLN02958 <142..608 CDD:215517 167/495 (34%)
DAGK_cat 147..286 CDD:279163 57/142 (40%)
Substrate binding. {ECO:0000250} 210..213 3/3 (100%)
NES. {ECO:0000250|UniProtKB:Q9NRA0} 381..390 0/9 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108634797
eggNOG 1 0.900 E1_COG1597
Hieranoid 1 1.000
Homologene 1 1.000 H32456
Inparanoid 1 1.050 260 1.000 Inparanoid score I3082
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D681139at2759
OrthoFinder 1 1.000 FOG0001202
OrthoInspector 1 1.000 T617029
orthoMCL 1 0.900 OOG5_128162
Panther 1 1.100 O PTHR12358
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R653
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.